GapMind for catabolism of small carbon sources

 

Aligments for a candidate for amaB in Shewanella sp. ANA-3

Align Putative aldehyde dehydrogenase transmembrane protein; EC 1.2.1.3 (characterized, see rationale)
to candidate 7023382 Shewana3_0612 succinylglutamic semialdehyde dehydrogenase (RefSeq)

Query= uniprot:Q92L07
         (510 letters)



>lcl|FitnessBrowser__ANA3:7023382 Shewana3_0612 succinylglutamic
           semialdehyde dehydrogenase (RefSeq)
          Length = 487

 Score =  177 bits (450), Expect = 6e-49
 Identities = 152/489 (31%), Positives = 228/489 (46%), Gaps = 25/489 (5%)

Query: 30  GGDMPSFSPVTGEKIASLKTVSAAEAAGKIEKADEAFRAWRLVPAPKRGELVRLLGEELR 89
           G D+ S +P   E I   +T +A +    ++ A EA   W ++    R ++V     +L 
Sbjct: 14  GHDVTSSNPANSEIIWRGQTATAEQVNAAVDAAREAQFDWFMLGFDGRLKIVEAYRSQLE 73

Query: 90  AFKADLGRLVSIEAGKIPSEGLGEVQEMIDICDFAVGLSRQLYGLTIATER---PGHRMM 146
           A KA+L   ++ E GK   E   EV  MI      +GLS   Y     TE    P  R +
Sbjct: 74  ANKAELAETIAQETGKPQWETATEVAAMIG----KIGLSATAYNKRTGTEANDTPAGRAV 129

Query: 147 ETWHPLGVVGIISAFNFPVAVWSWNAALALVCGDAVVWKPSEKTPLTALACQAILERAIA 206
               P GVV +   +NFP  + + +   AL+ G+ VV+KPSE TP  A    ++ E+A  
Sbjct: 130 LRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPKVAELMVSLWEKA-- 187

Query: 207 RFGDAPEGLSQVLIGDRAIGEVLVDHPKVPLVSATGSTRMGREVGPRLAKRFARAI-LEL 265
                P G+  ++ G+   G+ L  HP++  +  TGS+R G  +  + A    + + LE+
Sbjct: 188 ---GLPAGVINLVQGEVDTGKALASHPQLDGLFFTGSSRTGHLLHQQYAGHPGKILALEM 244

Query: 266 GGNNAGIVCPSADLDMALRAIAFGAMGTAGQRCTTLRRLFVHESVY-DQLVPRLKKAYQS 324
           GGNN  I+   AD+  A+  I   A  ++GQRCT  RRL+V +    D LV +L +A + 
Sbjct: 245 GGNNPLIIKGVADIKAAVHDILQSAYISSGQRCTCARRLYVEQGEQGDALVAKLVEAVKQ 304

Query: 325 VSVGN-PLESAALVGPLVDKAAFDGMQKAIAEAKNHGGAVTGGERVELGH--ENGYYVKP 381
           + VG    +    +G ++ +AA  GM  A A  +N GG       VEL H       V P
Sbjct: 305 IKVGPWNAQPQPFMGSMISEAAAKGMVAAQANLQNLGGV----SLVELSHLQAGTGLVSP 360

Query: 382 ALVEMPKQEGPVLEETFAPILYVMKYSDFDAVLAEHNAVAAGLSSSIFTRDMQESERFLA 441
            L+++        EE F P+L +++YSDFD  +   N    GLS+ I      + E FLA
Sbjct: 361 GLIDVTAVGELPDEEYFGPLLQLVRYSDFDQAIKLANQTRYGLSAGILADSRDDYEYFLA 420

Query: 442 ADGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDA--WKAYMRRATNTVNYSKAL 499
                 GI N N   +GA     FGG   +G  R S   A  + AY   +      S   
Sbjct: 421 R--IRAGIVNWNKQITGASGAAPFGGVGASGNHRASAFYAADYCAYPVASVEADAVSLPA 478

Query: 500 PLAQGVSFD 508
            L+ G+S +
Sbjct: 479 SLSPGLSLE 487


Lambda     K      H
   0.317    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 546
Number of extensions: 33
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 510
Length of database: 487
Length adjustment: 34
Effective length of query: 476
Effective length of database: 453
Effective search space:   215628
Effective search space used:   215628
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory