Align Butyrate--acetoacetate CoA-transferase subunit A; Short=Coat A; EC 2.8.3.9 (characterized, see rationale)
to candidate 7024489 Shewana3_1667 3-oxoacid CoA-transferase, A subunit (RefSeq)
Query= uniprot:P33752 (218 letters) >FitnessBrowser__ANA3:7024489 Length = 234 Score = 172 bits (435), Expect = 6e-48 Identities = 88/215 (40%), Positives = 130/215 (60%) Query: 1 MNSKIIRFENLRSFFKDGMTIMIGGFLNCGTPTKLIDFLVNLNIKNLTIISNDTCYPNTG 60 +N + +E + D MTIM+GGF CG P LI+ +V + IK LT ISN+ + G Sbjct: 4 LNKVVSSYEEALTGLSDDMTIMVGGFGLCGIPEGLINQMVKMGIKGLTAISNNAGVDDFG 63 Query: 61 IGKLISNNQVKKLIASYIGSNPDTGKKLFNNELEVELSPQGTLVERIRAGGSGLGGVLTK 120 +G L+ + Q+ +IASY+G N +++ + EL V L+PQGTL E+IRAGG+G+ T Sbjct: 64 LGLLLKHRQISTMIASYVGENATFEQQMLSGELNVILTPQGTLAEKIRAGGAGIPAFFTA 123 Query: 121 TGLGTLIEKGKKKISINGTEYLLELPLTADVALIKGSIVDEAGNTFYKGTTKNFNPYMAM 180 TG GT + +GK+ I G Y+LE LTAD AL++ D GN ++ T NFNP MA Sbjct: 124 TGYGTPVAEGKETREIKGRHYVLEESLTADFALVRAWKADTMGNLVFRKTAANFNPMMAT 183 Query: 181 AAKTVIVEAENLVSCEKLEKEKAMTPGVLINYIVK 215 A K +VEAE +V +L+ TPG+ ++ +++ Sbjct: 184 AGKITVVEAEFIVEPGELDPGHIHTPGIYVDRVIQ 218 Lambda K H 0.315 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 234 Length adjustment: 22 Effective length of query: 196 Effective length of database: 212 Effective search space: 41552 Effective search space used: 41552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory