Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate 7024284 Shewana3_1476 D-isomer specific 2-hydroxyacid dehydrogenase, catalytic region (RefSeq)
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__ANA3:7024284 Length = 376 Score = 88.6 bits (218), Expect = 2e-22 Identities = 77/255 (30%), Positives = 116/255 (45%), Gaps = 32/255 (12%) Query: 39 LKDADGGIGSSV-KITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTE 97 ++DAD + SV ++ A+L+ ++LK + + ++G D D+A L RGI +N P Sbjct: 35 VQDADVLLVRSVTRVNAALLDANSKLKFVGSATIGTDHVDLAYLAGRGIPFSNAPGCNAT 94 Query: 98 STADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVA 157 + + F +L A R F ++GK +GIVG G G A A Sbjct: 95 AVGEFAFIAMLELAAR---------------------FNSPLKGKVVGIVGAGNTGSATA 133 Query: 158 RRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTP----ETKHL 213 + + +KVL + +A E V L LL AD + L VP+T +T HL Sbjct: 134 K-CLEAYGIKVLLNDPI---KAAEGDPRHFVSLETLLHEADIISLHVPITRTGEHKTLHL 189 Query: 214 IGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKL 273 A + S+K + L+N RG +D +ALI+ + LDV+E EP P P L Sbjct: 190 FDEARMMSLKPNTWLLNCCRGDVIDNQALIKVKEQRDDLKLVLDVWEGEPNP--MPELVP 247 Query: 274 ANVVALPHIGSATHE 288 A PHI + E Sbjct: 248 FAEFATPHIAGYSLE 262 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 376 Length adjustment: 29 Effective length of query: 292 Effective length of database: 347 Effective search space: 101324 Effective search space used: 101324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory