GapMind for catabolism of small carbon sources

 

Aligments for a candidate for malI in Shewanella sp. ANA-3

Align The maltose/maltooligosaccharide transporter, MalI (541 aas) (characterized)
to candidate 7024747 Shewana3_1925 major facilitator transporter (RefSeq)

Query= TCDB::Q9A612
         (541 letters)



>lcl|FitnessBrowser__ANA3:7024747 Shewana3_1925 major facilitator
           transporter (RefSeq)
          Length = 531

 Score =  573 bits (1476), Expect = e-168
 Identities = 291/496 (58%), Positives = 356/496 (71%), Gaps = 11/496 (2%)

Query: 44  LSFLQIWNMCFGFFGIQIGFGLQNANTSRIFQSLGVDVNHLAILWIAAPATGLLVQPIIG 103
           L+F QI+NMCFGF GIQ GF LQNAN SRIFQ+LG  ++ + ILWIAAP TGLLVQPIIG
Sbjct: 30  LNFWQIFNMCFGFLGIQFGFALQNANVSRIFQTLGASIDDIPILWIAAPLTGLLVQPIIG 89

Query: 104 HFSDKTWGRFGRRRPYFFWGAILTTLALLVMPNSPTLWVAAAALWIMDASINITMEPFRA 163
           + SD TWGR GRRRPYF  GAI TTLA+ VMP+SPTLW+AA  LWIMDASINI MEPFRA
Sbjct: 90  YLSDNTWGRLGRRRPYFLIGAICTTLAIFVMPHSPTLWIAAGMLWIMDASINIAMEPFRA 149

Query: 164 FVGDNLPDEQRATGYAMQSFFIGLGAVFASALPWMLTNWFDVANTAPAGQVPDSVRIAFY 223
           FVGDNLP +QR  GYAMQSFFIG+GAV ASALP++L+N+FDVANTAPAG++ DSVR AFY
Sbjct: 150 FVGDNLPPKQRTQGYAMQSFFIGIGAVVASALPYVLSNYFDVANTAPAGEIADSVRYAFY 209

Query: 224 TGGAGLLLAVLWTVFTTREYSPEQLTAFEKAEREIAGLGLHEEPEPSVNAYIALGVGGVL 283
            GGA L L+V WTV +T+EYSP++L AF       AG    +    +   Y    +  + 
Sbjct: 210 FGGAVLFLSVAWTVVSTKEYSPDELAAFH--GNADAGADEQQHRTRTHKNYQFAAIVWMA 267

Query: 284 LGAALALIVWGAGLEKELYVLAGLLFAFGLAGVAGARFKRIGRTDNG-------FSEVLA 336
           +GA L   VW   L+K+LY+L   +F FG   +  A   R+G++             V+ 
Sbjct: 268 VGALLTFAVWAQDLDKQLYILTLGIFVFGPLQLYCA--LRLGKSTPSQRAQLGIVFNVVD 325

Query: 337 DVFRMPKTMRQLAVVQFFSWFGLFAMWIYTTPAVATVHFGAVDASSKAYNEGADWVGVLF 396
           D+F MPK M QLA+VQFFSWF LFAMWIYTT AV + HFG+ D  SKAYN+GADWVGVLF
Sbjct: 326 DLFHMPKAMHQLAIVQFFSWFALFAMWIYTTSAVTSYHFGSSDVLSKAYNDGADWVGVLF 385

Query: 397 AVYNGVAALAALVIPLMVKVTSRRVSHAVCLGLGALGLLSFLVIRDPGLLWIGMVGVGFA 456
           A YNG +A+AAL IPL+ K    +++H   +  G  GL+SF  I+DP LLW+ M+GVG A
Sbjct: 386 ASYNGFSAIAALFIPLLAKRIGIKLTHTFNMFCGGFGLISFYFIKDPSLLWLPMIGVGIA 445

Query: 457 WSSILSTPYSILAGALPARKMGVYMGIFNVFIVVPQLLAATLLGLMLKTFFGNQSIFALV 516
           W+SILS PY++L+GALP +KMGVYMGIFN FIV+PQLLAA++LGL+L   F  Q I+AL+
Sbjct: 446 WASILSVPYAMLSGALPPKKMGVYMGIFNFFIVIPQLLAASVLGLILNGLFDGQPIYALI 505

Query: 517 LGALSFALAAAATFLV 532
            G +    A  A   V
Sbjct: 506 TGGVLMLCAGIAVLFV 521


Lambda     K      H
   0.327    0.140    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 857
Number of extensions: 31
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 541
Length of database: 531
Length adjustment: 35
Effective length of query: 506
Effective length of database: 496
Effective search space:   250976
Effective search space used:   250976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory