GapMind for catabolism of small carbon sources

 

Aligments for a candidate for susB in Shewanella sp. ANA-3

Align α-glucosidase (SusB;Aglu;BFO_2272) (EC 3.2.1.20) (characterized)
to candidate 7024753 Shewana3_1931 alpha-glucosidase (RefSeq)

Query= CAZy::AEW20125.1
         (708 letters)



>lcl|FitnessBrowser__ANA3:7024753 Shewana3_1931 alpha-glucosidase
           (RefSeq)
          Length = 703

 Score =  506 bits (1303), Expect = e-147
 Identities = 284/706 (40%), Positives = 402/706 (56%), Gaps = 66/706 (9%)

Query: 17  LVSAPFTMRAEELKSPDGNLLMRFEVNGEGTPVYELTYKRKPVIKPSRLGLEIEGFS-LR 75
           L+    T +   L SPD  +++    +  G P Y++ +  K +I+PSRLGL       L 
Sbjct: 39  LLCTSATAQTLNLSSPDKQIVLSLS-DDTGRPEYQIHFHGKSIIEPSRLGLVFASLGELG 97

Query: 76  KAFTLKGVETVTFDETWTPVWGEVKAIRNHYNEMTATLHQADGDRTMVIRFRLYDDGLGF 135
           +   +K   + + DE W   WGE + I++ +N+++  L   DG   + + F+ +DDG+GF
Sbjct: 98  QGLRIKSSHSASADEQWQQPWGEQEWIKDQHNQLSVVL--TDGKIDLNLEFKAFDDGIGF 155

Query: 136 RYEFPQQKSL---NYFVIKEEYSEFAMAGDHKA--FWIPG-DYDTQEYDYTESRLTEIRG 189
           RY    Q +L       I +E +EF +    KA  +WIP   ++  EY Y  S L ++  
Sbjct: 156 RYHLAAQHALPNNTPLAITDELTEFNIGQSDKATAWWIPSRGWNRYEYLYRTSALNQV-- 213

Query: 190 LMQTAITPNTSQTPFSPTGVQTALMMKSDDGLYINLHEAALVDYPCMSLNLDDQTLTFQS 249
                   + + TPF+          K  DG ++++HEAALVD+  M+L+   +    ++
Sbjct: 214 --------DRAHTPFT---------FKLVDGTHLSIHEAALVDFASMTLD-QQRDGKLKA 255

Query: 250 WLTPDAQGKKGYMQTPCHTPWRTVIVSDDARRILASHLTLNLNEPCKLDDVSWIRPVKYI 309
            LTP + G +   Q   +TPWRT+ ++D A  +L SHL LNLNEP KL DVSW++P KY+
Sbjct: 256 DLTPWSDGIRVKTQAGFYTPWRTIQIADKATGLLNSHLILNLNEPNKLGDVSWVKPGKYV 315

Query: 310 GVWWEMISGKSTWAYTNDLPSVHLDVTDYTKMKPNGTHAANNEKVRRYIDFAAKHGFDQV 369
           G+WW M   ++TW                       TH A   +  RY+DFAAK+ FD V
Sbjct: 316 GIWWGMHLNENTWG-------------------SGPTHGATTSETERYMDFAAKYQFDGV 356

Query: 370 LVEGWNIGWE-DWFGNSKDYVFDFVTPYPDFDLKALNEYAHSKGVKLMMHHETSSSVRNY 428
           LVEGWN GW+ DWF N     F F   Y DFDL A+  Y   KGV+L+ HHET+ SV +Y
Sbjct: 357 LVEGWNQGWDGDWFHNGDQ--FSFTKAYDDFDLPAITAYGAKKGVRLIGHHETAGSVTHY 414

Query: 429 ERQMEKAYKLMNDYGYNAVKSGYVG----------NIIPRGEYHYGQWMVNHYLYAVKKA 478
             QM+ A+ L   +G   VK+GYV           N I R E+H GQ+MV  YL++V +A
Sbjct: 415 RNQMDDAFALYEKHGVTQVKTGYVADGGQIKRIDENGITRHEWHDGQFMVGEYLHSVTEA 474

Query: 479 AEHRIMVNAHEAVRPTGLCRTYPNLIGNEAARGGEYESFGG--NKVFHTTILPFTRLMGG 536
           A+H I +N+HE ++ TGL RTYPN +  E ARG EY ++G   N   HT +LPFTR++ G
Sbjct: 475 AKHHISINSHEPIKDTGLRRTYPNWLAREGARGQEYNAWGSPPNNPEHTAMLPFTRMLAG 534

Query: 537 PMDYTPGIFETRLEKVNPGNNSYVHSTLARQLALYVTMYSPLQMAADLPENYERFMDAFQ 596
           PMD+TPGIF+   + ++  N   V +TL +QLALYV +YSP+QMAADLP NY++ +DAFQ
Sbjct: 535 PMDFTPGIFDLAPKGLDAENR--VQTTLMKQLALYVVLYSPIQMAADLPRNYQKHLDAFQ 592

Query: 597 FIKDVAIDWDDSKYLEAEPGRYITVARKAKGTNNWFVGCTANEDGHLSNVSLDFLDPGRK 656
           FI+DV  DW  S  L  E G Y+  AR+AK   +W++G   +E+     V LDFLDP ++
Sbjct: 593 FIRDVPTDWYQSIALAGEVGDYVVFARQAKDQQDWYLGALTDENTREVKVKLDFLDPNKR 652

Query: 657 YTATIYADAPTAHYEKNPQAYTIKQMKVTNKSKLTLRAASGGGYAI 702
           Y A IY D   A ++ NP  Y I+  +V  K  LTL+ AS GG AI
Sbjct: 653 YQAQIYRDGAKADWKTNPYDYVIETKEVNAKDSLTLQLASSGGTAI 698


Lambda     K      H
   0.319    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1471
Number of extensions: 82
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 708
Length of database: 703
Length adjustment: 39
Effective length of query: 669
Effective length of database: 664
Effective search space:   444216
Effective search space used:   444216
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory