Align Inositol transport system ATP-binding protein (characterized)
to candidate 7024900 Shewana3_2074 ABC transporter related (RefSeq)
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__ANA3:7024900 Length = 499 Score = 171 bits (432), Expect = 4e-47 Identities = 94/240 (39%), Positives = 146/240 (60%), Gaps = 5/240 (2%) Query: 7 LIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILF 66 ++ ++ I KH+ V AL VS+ +F GE H LLG+NGAGKST +K M+G GDILF Sbjct: 4 ILELKQISKHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDILF 63 Query: 67 EGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANR 126 G+P HF P DA AGI+TV+Q + ++P ++V++N F+G EP R++G L F YA+ Sbjct: 64 LGEPQHFNTPMDAQKAGISTVYQEVNLVPNLTVAQNLFLGYEP-RRLG-LIHFKKMYADA 121 Query: 127 ITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTAN 186 + K+ I++ P + S +Q +AIAR V AKVL+LDEPT++L ++ Sbjct: 122 RAVLTQFKLDIDVSAP---LSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQV 178 Query: 187 VLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMAG 246 + +++++ +GVA+VFITH + + DR TVL G+ +G ++ +L + M G Sbjct: 179 LFGILNQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELPQPKLIEAMLG 238 Score = 68.9 bits (167), Expect = 2e-16 Identities = 52/229 (22%), Positives = 106/229 (46%), Gaps = 5/229 (2%) Query: 22 ALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFEGQPLHFADPRDAIA 81 ++ +++ V G+ L G G+G+S + G+ G I GQ L+ + P DAI+ Sbjct: 273 SIQSMNLTVPKGQAVGLAGLLGSGRSEVCNAVFGLDLVDSGSIHLAGQKLNLSQPVDAIS 332 Query: 82 AGIATVHQHL---AMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANRITMEEMRKMGIN 138 AGIA + +I +S+ N + + +IG + + I + K+ I Sbjct: 333 AGIALCPEDRKIDGIIGPLSIRENIILALQA--RIGWWRYLSNTRQQEIAQFFIDKLQIA 390 Query: 139 LRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANVLATIDKVRKQG 198 D+ + LSGG +Q V +AR + +L+LDEPT + + A ++ I + +G Sbjct: 391 TPDADKPIEQLSGGNQQKVILARWLAIEPILLVLDEPTRGIDIGAHAEIVKLIRTLCDEG 450 Query: 199 VAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMAGG 247 ++++ + + +A ++ VL + +++++ + +A G Sbjct: 451 MSLLVASSELDELVAFSNKVVVLRDRYAVRELSGAELTSQHVMQAIAEG 499 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 261 Length of database: 499 Length adjustment: 29 Effective length of query: 232 Effective length of database: 470 Effective search space: 109040 Effective search space used: 109040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory