GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pimF in Shewanella sp. ANA-3

Align 6-carboxyhex-2-enoyl-CoA hydratase (characterized)
to candidate 7024269 Shewana3_1461 multifunctional fatty acid oxidation complex subunit alpha (RefSeq)

Query= metacyc::MONOMER-20678
         (699 letters)



>lcl|FitnessBrowser__ANA3:7024269 Shewana3_1461 multifunctional
           fatty acid oxidation complex subunit alpha (RefSeq)
          Length = 709

 Score =  378 bits (971), Expect = e-109
 Identities = 254/703 (36%), Positives = 368/703 (52%), Gaps = 29/703 (4%)

Query: 10  QDQVAIVTVDSP--PVNALSAAVRRGILENVNAAVADPAVQAIVLVCAGR-TFIAGADIT 66
           +D +AI+ +D P   +N L A     I E ++    D +++ +VL+   + +F+AGADI+
Sbjct: 11  EDGIAILMMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKKDSFVAGADIS 70

Query: 67  EFGK---PPQPPALND----VIAALENSPKPTIAAIHGTALGGGLEVALGCHFRVAVKEA 119
                       AL+     V   LE    P +AAIHG  LGGGLE+AL CH RV   + 
Sbjct: 71  MLDACQTAGDAKALSQQGHVVFNELEALNIPVVAAIHGACLGGGLELALACHQRVCSDDG 130

Query: 120 K--LGLPEVKLGLLPGAGGTQRLPRAVGPELAVQMIVGGSPIGAAEALKHGLVEEVVEN- 176
           K  LG+PEV+LGLLPG GGTQRLPR VG   A+ M++ G  I   +ALK GLV +VV   
Sbjct: 131 KTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVNDVVPQT 190

Query: 177 -LVAGAVAFAKKVLAEKRPLRRLRDDDSKLAAAKADRSIFTNAVAAMTKKARG-LEAPFA 234
            L+  AV  A       +P+++   +            IF  A   + KK +G   AP  
Sbjct: 191 ILLQTAVEMALAGKRTAKPVKKSLVNQLLEGTGFGRNIIFDQAAKQVVKKTQGNYPAPAK 250

Query: 235 CADAIGAAIDLPFEEGLKKEREGFMKLVVSDQSKAQRYAFFAEREAAKVDGVPDGTKPRP 294
             D +   +    ++GL+ E   F +LVVS +S+A R  FFA  E  K  G  +G  PR 
Sbjct: 251 IIDCVRQGMAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKETGA-EGATPRK 309

Query: 295 VSRVAIIGAGTMGGGIA-MSFANAGIPVTLIETGEEQLKRGLGIMQKNWEATAARGGLPP 353
           V +  I+G G MGGGIA ++   A IP  + +  E+ L   L    K  +    R  + P
Sbjct: 310 VKKAVILGGGLMGGGIASVTTTKAKIPARVKDINEKGLSNALSYAYKLLDKGVKRRHMTP 369

Query: 354 DAPAKRMALITGLVGLENVKDADLIIEAVFETMAVKKEVFTAVDAHAKPGAVLASNTSYL 413
                 MAL+T     + VKDAD+++EAVFE +A+K ++   ++       + ASNTS L
Sbjct: 370 AVRDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHTIFASNTSSL 429

Query: 414 SIDEIAATTKRPQDVLGMHFFSPANVMKLCEIVRGAKTAPDALLTAVSIAKKIAKVPVVV 473
            I +IA    RP++V+G+H+FSP   M L E++  AKT+P+ + T V+ A+K  K P+VV
Sbjct: 430 PIGQIAQAASRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFARKQGKTPIVV 489

Query: 474 GVCDGFVGNRMLAARSKQSEKLLFEGALPQQVDAVVTKFGMPMGPFAMGDLAGLDIGWR- 532
               GF  NR+LA    ++ +LL EG   + +D  + KFG P+GP  + D  G+D+G + 
Sbjct: 490 QDGAGFYVNRILALYMNEAAQLLLEGQSIEHLDKALVKFGFPVGPITLLDEVGIDVGAKI 549

Query: 533 ---SRKDRG--IKSEIA-DALCEAGRFGQKTGKGYYKYEQGSRAPMPDPEVETLINDTLA 586
                K+ G   K+  A D L    R G+K GKG+Y+Y  G++A      V+       A
Sbjct: 550 APILEKELGERFKAPAAFDKLLSDDRKGRKNGKGFYQYAAGNKASSKKKAVD---ESVYA 606

Query: 587 KLGLK-RRDITDEEILERMVYPMINEGARILEEKIAARPSDIDVVWLYGYGWPIYRGGPM 645
            LG+K   D     + ER V  M+NE  R L++ I A P D D+  ++G G+P + GGP 
Sbjct: 607 VLGIKPGMDKDLSAVAERCVVQMLNEAVRCLDDGIIASPRDGDIGAIFGIGFPPFLGGPF 666

Query: 646 HYADSVGLKHIAERLSAYAKATNDPSLEPAPLLARLAAEGKTF 688
           HY D++G  ++   L  Y     D   EP P L  +AAE   F
Sbjct: 667 HYIDTLGADNLVNILERYQAQYGD-RFEPCPRLKAMAAEKARF 708


Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 998
Number of extensions: 52
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 699
Length of database: 709
Length adjustment: 39
Effective length of query: 660
Effective length of database: 670
Effective search space:   442200
Effective search space used:   442200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory