Align 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) (characterized)
to candidate 7025629 Shewana3_2780 pterin-4-alpha-carbinolamine dehydratase (RefSeq)
Query= BRENDA::Q48G05 (118 letters) >FitnessBrowser__ANA3:7025629 Length = 112 Score = 176 bits (446), Expect = 8e-50 Identities = 75/108 (69%), Positives = 95/108 (87%) Query: 1 MSTLNQAHCEACRADAPQVSEAELPELLKQIPDWNIEVRDGVMQLEKVFLFKNFKFALAF 60 M+ L Q CEAC+ADAP+V++AEL EL++ +PDW ++VRDG+MQLE+V+ FKNFK A+AF Sbjct: 1 MTALTQMKCEACQADAPKVTDAELAELIRMVPDWGVQVRDGIMQLERVYKFKNFKLAMAF 60 Query: 61 TNAVGEIAEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMAARTD 108 TN + ++AE E HHPG+LTEWGKVTVTWWSHSIKGLH+NDFIMAA+TD Sbjct: 61 TNKLADLAEEEFHHPGILTEWGKVTVTWWSHSIKGLHKNDFIMAAKTD 108 Lambda K H 0.319 0.133 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 82 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 118 Length of database: 112 Length adjustment: 13 Effective length of query: 105 Effective length of database: 99 Effective search space: 10395 Effective search space used: 10395 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory