Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate 7025598 Shewana3_2749 ABC transporter related (RefSeq)
Query= uniprot:D8IUY7 (241 letters) >FitnessBrowser__ANA3:7025598 Length = 346 Score = 113 bits (282), Expect = 6e-30 Identities = 71/224 (31%), Positives = 128/224 (57%), Gaps = 7/224 (3%) Query: 6 LKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIE 65 ++ + ++ A+GGI AV+ +DL + +G + +G NG GK+T+++ +TG L S G I Sbjct: 29 IETRGMTRAFGGINAVEDLDLAIPKGTIYGFLGPNGCGKSTSIRMLTGLL--SPTSGDIR 86 Query: 66 YLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSD-DKGQIAADIDKWF 124 LG+ L G + E ++ ++ + + ++ +S++ENL A ++ Q A + + Sbjct: 87 VLGETLPGAE--EKLRRRIGYMTQKFSLYDNLSVRENLEFVAQIYGLNRRQTKARLAELL 144 Query: 125 AVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIR 184 +++ L R QMAG++SGG++Q LA+A A + HP+LL LDEP+ + P + +E + Sbjct: 145 SLYD-LAGREKQMAGSMSGGQKQRLALAAATLHHPELLFLDEPTSAVDPENRREFWERLF 203 Query: 185 NVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQML 228 ++ AQG TI LV + E H ++E G+ G QQ++ Sbjct: 204 DLCAQGTTI-LVSTHYMDEAERCHGLAILERGIKRADGSPQQLM 246 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 346 Length adjustment: 26 Effective length of query: 215 Effective length of database: 320 Effective search space: 68800 Effective search space used: 68800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory