GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ectP in Shewanella sp. ANA-3

Align Glycine betaine/proline/choline transporter VP1723 (characterized)
to candidate 7025568 Shewana3_2719 choline/carnitine/betaine transporter (RefSeq)

Query= SwissProt::Q87NZ5
         (553 letters)



>lcl|FitnessBrowser__ANA3:7025568 Shewana3_2719
           choline/carnitine/betaine transporter (RefSeq)
          Length = 658

 Score =  433 bits (1114), Expect = e-126
 Identities = 223/508 (43%), Positives = 317/508 (62%), Gaps = 25/508 (4%)

Query: 41  IHNRVFAISGMAIVLFVVATLTFRQQVEPFFAGLRAWLVSNLDWFFLASGNVFVIVCLVL 100
           I+  VF  S   I L V+    +  +   FF  +++WL +   W ++    +F+I  + +
Sbjct: 7   INPPVFYSSVFFITLMVMICAIWPTEANHFFKSMQSWLEAKAGWLYILGVAIFLIFIIFV 66

Query: 101 IVTPLGRVRIGGTEATPDYSYAGWLAMLFAAGMGIGLVFFGVSEPMSHFSSALGGVNIEN 160
           +V+  G +++G   A PDYSY  W+AMLF+AGMGIGL+FFGV+EP+ H+ +         
Sbjct: 67  MVSRFGDIKLGPDHAVPDYSYKSWIAMLFSAGMGIGLMFFGVAEPVMHYLAP-------- 118

Query: 161 GVRTDWAPLGGAVGDTDAASALGMAATIYHWALHPWSIYALLALGLAIFSFNKGLPLTMR 220
                      A  ++ AA+   M  T +HW +H W+IY ++AL LA F++   LPL  R
Sbjct: 119 ---------PDATPESLAAAKEAMKITFFHWGIHAWAIYGVVALSLAYFAYRHKLPLLPR 169

Query: 221 SIFYPLFGERVWGWVGHIIDILAVVATVFGLATSLGYGASQAATGLNFLFG-VPMTDTTQ 279
           S  YPL GER+ G +GH +D  AV+ T+FG+ATSLG+G  Q  +GL++LF  +P   T Q
Sbjct: 170 SALYPLIGERIHGPIGHCVDTFAVLGTMFGVATSLGFGVLQVNSGLSYLFEQLPNNTTVQ 229

Query: 280 VVLIVVITALALISVVAGLDSGVKRLSEINMILAAMLLFFVIIVGPTMAILTGFFDNIAS 339
           V LI+ IT LA +SV +GLD GVKRLSE+N+ LA +LL  V+I+GPT+ +L  F  N  S
Sbjct: 230 VSLIIGITLLATLSVFSGLDKGVKRLSELNLGLALILLLIVLILGPTVMLLQAFVQNTGS 289

Query: 340 YITNI--PALSMPFEREDVNYSQGWTAFYWAWWISWSPFVGMFIARVSRGRSVREFIICV 397
           Y+++I     ++   +   ++  GWT  YW WWISWSPFVG FIARVSRGR++REF++ +
Sbjct: 290 YLSDIVNKTFNLYAYQHKEDWLGGWTLLYWGWWISWSPFVGTFIARVSRGRTIREFLVGI 349

Query: 398 ILIPSTVCVLWMTAFGGTAISQYVNDGY----EAVFNAELPLKLFAMLDVMPFAEITSVV 453
           + +PS +  LWMT FG +AI   +N G     EAV N  +P+ LF   + MPF  + S +
Sbjct: 350 LFVPSALTFLWMTVFGNSAIDAIMNQGATYLSEAV-NTNVPVALFVFFEHMPFPHLLSGI 408

Query: 454 GIILVVVFFITSSDSGSLVIDTIAAGGKVDAPTPQRVFWCTFEGLVAIALMLGGGLAAAQ 513
           GI LVV FF+TSSDSGSLVID + +GG  +AP  QRVFW   +G+VA  L+L GGL A Q
Sbjct: 409 GICLVVTFFVTSSDSGSLVIDNLTSGGDNNAPVWQRVFWALLQGVVASVLLLAGGLQALQ 468

Query: 514 AMAVTTGLPFTIVLLVATVSLIKGLMDE 541
             A+ + +PF  V+L+  + L K L D+
Sbjct: 469 TAAIASAMPFLCVMLLMCLGLYKALKDD 496


Lambda     K      H
   0.327    0.141    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 941
Number of extensions: 46
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 553
Length of database: 658
Length adjustment: 37
Effective length of query: 516
Effective length of database: 621
Effective search space:   320436
Effective search space used:   320436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory