GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpB in Shewanella sp. ANA-3

Align isocitrate lyase (EC 4.1.3.1) (characterized)
to candidate 7025792 Shewana3_2942 isocitrate lyase (RefSeq)

Query= BRENDA::P9WKK7
         (428 letters)



>lcl|FitnessBrowser__ANA3:7025792 Shewana3_2942 isocitrate lyase
           (RefSeq)
          Length = 440

 Score =  530 bits (1366), Expect = e-155
 Identities = 267/427 (62%), Positives = 334/427 (78%), Gaps = 10/427 (2%)

Query: 11  EQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQLHD---LEWVN 67
           + I+++W  NPRWK+V R Y+AE+VVAL+GS+V E+T+A+RGA  LW+ ++      +VN
Sbjct: 14  DAIKKDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKLWDLVNGGAKKGYVN 73

Query: 68  ALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQVVRRINNA 127
           +LGALTG  AVQQ +AG++AIYLSGWQVA DANL+G  YPDQSLYPANSVP VV RINN+
Sbjct: 74  SLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPANSVPAVVARINNS 133

Query: 128 LQRADQIAKIEGDTSVE----NWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSHWED 183
            +RADQI    G    E    ++  PI+AD EAGFGG LN +EL K++I AG AG H+ED
Sbjct: 134 FRRADQIQWSNGVNPEEENFVDYFLPIIADAEAGFGGVLNAFELMKSMIDAGAAGVHFED 193

Query: 184 QLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSDVDE 243
           QLAS KKCGH+GGKVL+PTQ+ ++ L +ARLAADV+ V T+VIARTDA AA L+TSD D 
Sbjct: 194 QLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVETLVIARTDANAADLLTSDCDP 253

Query: 244 RDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEAVKA 303
            D+ F+TGERT EGFYR K G++  I+R  AYAP+ADLIW ET  PDLE AR+F+EA+ A
Sbjct: 254 YDRDFVTGERTSEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKPDLEEARRFAEAIHA 313

Query: 304 EYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFDLAY 363
           +YPDQ+LAYNCSPSFNWKK+LDDATIA+FQ+EL+ MG+K+QFITLAG H + Y+MFDLAY
Sbjct: 314 QYPDQLLAYNCSPSFNWKKNLDDATIARFQQELSDMGYKYQFITLAGIHNMWYNMFDLAY 373

Query: 364 GYAQNQ-MSAYVE-LQEREFAAEERGYTATKHQREVGAGYFDRIATTVD-PNSSTTALTG 420
            YA+ + M  YVE +QE EFAA ++GYT   HQ+EVG GYFD++ T +    SS TALTG
Sbjct: 374 DYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTTVIQGGQSSVTALTG 433

Query: 421 STEEGQF 427
           STEE QF
Sbjct: 434 STEEEQF 440


Lambda     K      H
   0.316    0.130    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 616
Number of extensions: 21
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 428
Length of database: 440
Length adjustment: 32
Effective length of query: 396
Effective length of database: 408
Effective search space:   161568
Effective search space used:   161568
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory