GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpB in Shewanella sp. ANA-3

Align 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 (characterized)
to candidate 7026692 Shewana3_3825 2-methylisocitrate lyase (RefSeq)

Query= SwissProt::Q8EJW1
         (292 letters)



>lcl|FitnessBrowser__ANA3:7026692 Shewana3_3825 2-methylisocitrate
           lyase (RefSeq)
          Length = 292

 Score =  566 bits (1458), Expect = e-166
 Identities = 289/292 (98%), Positives = 290/292 (99%)

Query: 1   MTQSAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANASYGLPDLGM 60
           MTQSAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANASYGLPDLGM
Sbjct: 1   MTQSAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANASYGLPDLGM 60

Query: 61  TSMNDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEKIGVAAVHMEDQVSQKR 120
           TSMNDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEK GVAAVHMEDQVSQKR
Sbjct: 61  TSMNDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEKAGVAAVHMEDQVSQKR 120

Query: 121 CGHRPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVEGLEAGIERAKAYIAAGA 180
           CGHRPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVEGLEAGIERAKAYIAAGA
Sbjct: 121 CGHRPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVEGLEAGIERAKAYIAAGA 180

Query: 181 DMIFAEALTELDQYRHFKAQVKAPILANMTEFGQTQLFNKEELAQAGADMVLYPLGTFRA 240
           DMIFAEALTELDQYRHFKAQV APILANMTEFGQTQLFNKEELA+AGADMVLYPLGTFRA
Sbjct: 181 DMIFAEALTELDQYRHFKAQVNAPILANMTEFGQTQLFNKEELAEAGADMVLYPLGTFRA 240

Query: 241 ANQAALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFSQDK 292
           ANQAALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFSQDK
Sbjct: 241 ANQAALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFSQDK 292


Lambda     K      H
   0.319    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 462
Number of extensions: 12
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 292
Length of database: 292
Length adjustment: 26
Effective length of query: 266
Effective length of database: 266
Effective search space:    70756
Effective search space used:    70756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate 7026692 Shewana3_3825 (2-methylisocitrate lyase (RefSeq))
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02317.hmm
# target sequence database:        /tmp/gapView.18792.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02317  [M=285]
Accession:   TIGR02317
Description: prpB: methylisocitrate lyase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   4.4e-132  425.5   4.1   5.1e-132  425.3   4.1    1.0  1  lcl|FitnessBrowser__ANA3:7026692  Shewana3_3825 2-methylisocitrate


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7026692  Shewana3_3825 2-methylisocitrate lyase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  425.3   4.1  5.1e-132  5.1e-132       2     284 ..       6     289 ..       5     290 .. 0.99

  Alignments for each domain:
  == domain 1  score: 425.3 bits;  conditional E-value: 5.1e-132
                         TIGR02317   2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaeearritrvtklpll 77 
                                       g ++r++l+++++lqi+G+ na+ al+ae++Gf+a+YlsGa++a+ s glPDlg+t++++v+ +a rit++t+lpll
  lcl|FitnessBrowser__ANA3:7026692   6 GLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANaSYGLPDLGMTSMNDVLIDAGRITSATQLPLL 82 
                                       579*****************************************989****************************** PP

                         TIGR02317  78 vDaDtGfGealnvartvkeleeagvaavhieDqvapkkCGhldgkelvskeemvkkikaavkakkdedfvliaRtDa 154
                                       vD+DtG+G+a+n+art+ke+e+agvaavh+eDqv +k+CGh+++k++vs+eemv++ikaav+a++d++fv++aRtDa
  lcl|FitnessBrowser__ANA3:7026692  83 VDIDTGWGGAFNIARTIKEFEKAGVAAVHMEDQVSQKRCGHRPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDA 159
                                       ***************************************************************************** PP

                         TIGR02317 155 raveGldaaieRakaYveaGadaiftealeseeefrefakavkvpllanmtefGktplltadeleelgykiviyPvt 231
                                        aveGl+a ieRakaY+ aGad+if+eal++++++r+f+++v++p+lanmtefG+t+l++ +el+e+g ++v+yP+ 
  lcl|FitnessBrowser__ANA3:7026692 160 VAVEGLEAGIERAKAYIAAGADMIFAEALTELDQYRHFKAQVNAPILANMTEFGQTQLFNKEELAEAGADMVLYPLG 236
                                       ***************************************************************************** PP

                         TIGR02317 232 alRaalkaaekvyeelkkkGtqkelldklqtRkelYellgyedyekkdkelfk 284
                                       ++Raa++aa kv++ l+++G q+++ld++qtR++lY+ lgy+++e+k+++lf 
  lcl|FitnessBrowser__ANA3:7026692 237 TFRAANQAALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFS 289
                                       **************************************************986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (285 nodes)
Target sequences:                          1  (292 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 9.77
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory