Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate 7023011 Shewana3_0249 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= SwissProt::Q9HK58 (254 letters) >FitnessBrowser__ANA3:7023011 Length = 253 Score = 103 bits (257), Expect = 3e-27 Identities = 77/250 (30%), Positives = 123/250 (49%), Gaps = 10/250 (4%) Query: 9 AVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVLETASKYGVKAHKVKVDQSDP 68 A+ITG SRG+G+ AL LA QG +I+++Y S+ + A EV+ +G KA + +D D Sbjct: 7 ALITGASRGLGKNAALTLAAQGVDIILTYQSNAAAAAEVVAEIEWHGRKAVALPLDVGDS 66 Query: 69 YE----SIRFAEKAIETF--GKVHILVDNAGICPFEDFFRISVDLFEKVWKVNVESHYFI 122 S+R +T+ + LV+NAGI SV+ F+ + ++V+ +F+ Sbjct: 67 QSFSDFSLRVKAALEQTWLRDSFNYLVNNAGIGIHVPMAETSVEQFDTLMNIHVKGPFFL 126 Query: 123 TQRIAKNMIENKINGRILLISSISAHVGGEFQTHYTTTKSALNGFMHSIAIVLGKYGILV 182 TQ + + + NG I+ +S+ Y K A+ A LG GI V Sbjct: 127 TQALLPLLAD---NGSIINVSTGLTRFAVPGFGAYAIMKGAVETMTKYWAKELGPRGIRV 183 Query: 183 NSLEPGTILTDINKEDL-SNQEKRAYMERRTVVGRLGLPEDMVAPALFLLSDDNTYVTGT 241 N L PG I TD + N + ++ ++T +GR+GLPED+ LLS ++ Sbjct: 184 NVLAPGAIETDFGGGAVRDNPKMNEFLAQQTALGRVGLPEDIGGAISVLLSPAAAWINAQ 243 Query: 242 ELLADGGMLI 251 + A GGM + Sbjct: 244 RIEASGGMFL 253 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory