Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate 7025539 Shewana3_2690 short chain dehydrogenase (RefSeq)
Query= metacyc::MONOMER-16230 (256 letters) >FitnessBrowser__ANA3:7025539 Length = 255 Score = 143 bits (361), Expect = 3e-39 Identities = 93/256 (36%), Positives = 135/256 (52%), Gaps = 10/256 (3%) Query: 2 LLIDKTVIVTGASRGIGRAAARECARQGARVVIGHSGSDEGRAGAL--SLAEEIAAFGGT 59 +L K I+TGAS GIG A A+ AR+GA++V+G R GA+ SL +EI GG Sbjct: 3 VLQGKVAIITGASSGIGYATAKRFAREGAKLVLG------ARRGAILASLVDEIITQGGE 56 Query: 60 AIAVGADAADLDSGEKLVAAAVEAFGSVDVLVNNAGICPFHSFLD--MPRELYLKTVGTN 117 AI + D D LVA AVE +G +D+ NN GI + R + T+ TN Sbjct: 57 AIYLAGDVTDEVYASDLVALAVEQYGGLDIAFNNVGINGELGVDSDALSRAEWENTLTTN 116 Query: 118 LNGAYFTVQAAARRMKEQGRGGAIIAVSSISALVGGAMQTHYTPTKAGLLSLMQSCAIAL 177 L A+ + +M ++G G I S + +G Y +KAG++ L QS A+ Sbjct: 117 LTSAFLAAKYQLPQMLKRGAGSIIFTSSFVGYTIGFPQTAAYAASKAGMIGLTQSLAVEY 176 Query: 178 GPYGIRCNAVLPGTIATDINKEDLSDLEKRERMTSRVPLGRLGEPDDLAGPIVFLASDMA 237 G GIR NA+LPG T + +E + E + + L RL +P ++A ++LASD A Sbjct: 177 GARGIRVNALLPGGTDTPMGREFANTPEAMAFVKNLHALKRLADPAEIAQSALYLASDAA 236 Query: 238 RYVTGASLLVDGGLFV 253 + TG +LLVDGG+ + Sbjct: 237 SFTTGIALLVDGGVSI 252 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 255 Length adjustment: 24 Effective length of query: 232 Effective length of database: 231 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory