GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rbsA in Shewanella sp. ANA-3

Align Ribose import ATP-binding protein RbsA 2, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate 7024900 Shewana3_2074 ABC transporter related (RefSeq)

Query= TCDB::Q9X051
         (523 letters)



>lcl|FitnessBrowser__ANA3:7024900 Shewana3_2074 ABC transporter
           related (RefSeq)
          Length = 499

 Score =  361 bits (926), Expect = e-104
 Identities = 192/503 (38%), Positives = 326/503 (64%), Gaps = 15/503 (2%)

Query: 11  VLLEARNITKTFPGVIAVNNVTLQIYKGEVCALVGENGAGKSTLMKILAGVYPDYEGQIF 70
           ++LE + I+K +PGV A+ +V+L+++ GEV AL+GENGAGKSTL+K++ G      G I 
Sbjct: 3   LILELKQISKHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDIL 62

Query: 71  LEGKEVRFRNPREAQENGIALIPQELDLVPNLSSAENIFLSREPVNEFGVIEYQKMFEQA 130
             G+   F  P +AQ+ GI+ + QE++LVPNL+ A+N+FL  EP    G+I ++KM+  A
Sbjct: 63  FLGEPQHFNTPMDAQKAGISTVYQEVNLVPNLTVAQNLFLGYEP-RRLGLIHFKKMYADA 121

Query: 131 SKLFSKLGVNIDPKTKVEDLSTSQQQMVAIAKALSLDAKIIIMDEPTSAIGKRETEQLFN 190
             + ++  ++ID    + D S + QQ++AIA+ +++ AK++++DEPT+++  +E + LF 
Sbjct: 122 RAVLTQFKLDIDVSAPLSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLFG 181

Query: 191 IIRSLKNEGKSVIYISHRLEEIFEIADRVVVMRDGRKVGEGPIEEFDHDKLVRLMVGRSI 250
           I+  LK +G ++++I+H L+++++I+DR+ V+R+G+ +GE    E    KL+  M+GRS+
Sbjct: 182 ILNQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELPQPKLIEAMLGRSL 241

Query: 251 DQFFI----KERATITDEIFRVEGIKLWSLDRK-KLLVDDVSFYVRKGEVLGIYGLVGAG 305
            +  +    KER T+T    R E + L   D   K  +  ++  V KG+ +G+ GL+G+G
Sbjct: 242 QEQLVDKQEKER-TVT----RAEAVLLSLEDVSVKGSIQSMNLTVPKGQAVGLAGLLGSG 296

Query: 306 RTELLEAIFGAHPGRTEGKVFIGGKEIKIHSPRDAVKNGIGLVPEDRKTAGLILQMSVLH 365
           R+E+  A+FG     + G + + G+++ +  P DA+  GI L PEDRK  G+I  +S+  
Sbjct: 297 RSEVCNAVFGLDLVDS-GSIHLAGQKLNLSQPVDAISAGIALCPEDRKIDGIIGPLSIRE 355

Query: 366 NITLPSVVMKLIVRKFGLIDSQLEKEIVRSFIEKLNIKTPSPYQIVENLSGGNQQKVVLA 425
           NI L    ++  +  +  + +  ++EI + FI+KL I TP   + +E LSGGNQQKV+LA
Sbjct: 356 NIIL---ALQARIGWWRYLSNTRQQEIAQFFIDKLQIATPDADKPIEQLSGGNQQKVILA 412

Query: 426 KWLAIKPKVLLLDEPTRGIDVNAKSEIYKLISEMAVSGMGVVMVSSELPEILAMSDRILV 485
           +WLAI+P +L+LDEPTRGID+ A +EI KLI  +   GM +++ SSEL E++A S++++V
Sbjct: 413 RWLAIEPILLVLDEPTRGIDIGAHAEIVKLIRTLCDEGMSLLVASSELDELVAFSNKVVV 472

Query: 486 MSEGRKTAEFLREEVTEEDLLKA 508
           + +     E    E+T + +++A
Sbjct: 473 LRDRYAVRELSGAELTSQHVMQA 495



 Score = 96.7 bits (239), Expect = 2e-24
 Identities = 66/243 (27%), Positives = 128/243 (52%), Gaps = 14/243 (5%)

Query: 283 VDDVSFYVRKGEVLGIYGLVGAGRTELLEAIFGAHPGRTEGKVFIGGKEIKIHSPRDAVK 342
           ++DVS  +  GEV  + G  GAG++ L++ + GA   +  G +   G+    ++P DA K
Sbjct: 20  LEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQ-SKDMGDILFLGEPQHFNTPMDAQK 78

Query: 343 NGIGLVPEDRKTAGLILQMSVLHNITLPSVVMKLIVRKFGLIDSQLEKEIVRSFIE--KL 400
            GI  V ++     L+  ++V  N+ L         R+ GLI  +      R+ +   KL
Sbjct: 79  AGISTVYQE---VNLVPNLTVAQNLFLGYEP-----RRLGLIHFKKMYADARAVLTQFKL 130

Query: 401 NIKTPSPYQIVENLSGGNQQKVVLAKWLAIKPKVLLLDEPTRGIDVNAKSEIYKLISEMA 460
           +I   +P   + + S   QQ + +A+ +A+  KVL+LDEPT  +D      ++ +++++ 
Sbjct: 131 DIDVSAP---LSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLFGILNQLK 187

Query: 461 VSGMGVVMVSSELPEILAMSDRILVMSEGRKTAEFLREEVTEEDLLKAAIPRSVKVETTQ 520
             G+ +V ++  L ++  +SDRI V+  G+   E+L  E+ +  L++A + RS++ +   
Sbjct: 188 AKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELPQPKLIEAMLGRSLQEQLVD 247

Query: 521 REE 523
           ++E
Sbjct: 248 KQE 250


Lambda     K      H
   0.317    0.137    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 583
Number of extensions: 30
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 523
Length of database: 499
Length adjustment: 35
Effective length of query: 488
Effective length of database: 464
Effective search space:   226432
Effective search space used:   226432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory