Align sorbitol-6-phosphate dehydrogenase (characterized)
to candidate 7025403 Shewana3_2558 3-oxoacyl-[acyl-carrier-protein] reductase (RefSeq)
Query= CharProtDB::CH_091826 (259 letters) >FitnessBrowser__ANA3:7025403 Length = 248 Score = 112 bits (281), Expect = 6e-30 Identities = 77/256 (30%), Positives = 132/256 (51%), Gaps = 18/256 (7%) Query: 3 QVAVVIGGGQTLGAFLCEGLAQAGYHVAVADLNESNANRLADTINSRYGAGRAYGFKVDA 62 +VA+V G + +G + E L +AG V +E A + + Y + +G ++ Sbjct: 10 KVALVTGASRGIGRAIAETLVEAGAIVVGTATSEKGAAAIQE-----YLGDKGFGLVLNV 64 Query: 63 TDEASVEALARAVDETFGRADLLVYSAGVAKAAPITQFRLTDFDLSLQVNLVGYFLCSRE 122 TD SV L ++ E G D+LV +AG+ + + + + +++ + NL F S+ Sbjct: 65 TDSQSVTDLFDSIKEKAGDVDILVNNAGITRDNLLMRMKDDEWNDIIDTNLTSLFRLSKP 124 Query: 123 FSKLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSL 182 + M++ GRII I S G +G+ YSAAK G +G T+SLA ++A ITV+++ Sbjct: 125 VMRTMMKKRF-GRIINIGSVVGTMGNAGQVNYSAAKAGLIGFTKSLAREVASRQITVNAI 183 Query: 183 MLGNLLKSPMFQSLLPQYAEKLGITPEEVEPYYVDKVPLKRGCDYQDVLNVLLFYASDKA 242 G +++ M L E+ + + +VP++R Q++ N +LF ASD A Sbjct: 184 APG-FIQTDMTDELT-----------EDQQKAIMSQVPMERLGQAQEIANAVLFLASDSA 231 Query: 243 AYCTGQSINVTGGQVM 258 AY TG++++V GG M Sbjct: 232 AYITGETLHVNGGMYM 247 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 248 Length adjustment: 24 Effective length of query: 235 Effective length of database: 224 Effective search space: 52640 Effective search space used: 52640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory