Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate 7025614 Shewana3_2765 3-ketoacyl-(acyl-carrier-protein) reductase (RefSeq)
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__ANA3:7025614 Length = 252 Score = 125 bits (315), Expect = 7e-34 Identities = 83/268 (30%), Positives = 138/268 (51%), Gaps = 28/268 (10%) Query: 5 LNLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQ------SSGNYNFWPT 58 ++LK+K++ +TGGA G+GLA+ GA + +ID+ + S+ + Sbjct: 1 MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQEKLERACADLGSATEVQGYAL 60 Query: 59 DISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNI 118 DI+ +V +I++ FG+I+ LVNNAG+ +LV K ++ F+ ++N+ Sbjct: 61 DITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVINV 120 Query: 119 NQKGVFLMSQAVARQMVKQ-RSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKE 177 N G FL + A M++ ++GVIVN+SS G+ GQS YAA+KA + + + W+KE Sbjct: 121 NLTGTFLCGREAAAAMIESGQAGVIVNISS-LAKAGNVGQSNYAASKAGVAAMSVGWAKE 179 Query: 178 LGKHGIRVVGVAPGIL--EKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRL 235 L ++ IR VAPG++ E T PE E L + +P+GR G+ Sbjct: 180 LARYNIRSAAVAPGVIATEMTAAMKPEALERL----------------EKLVPVGRLGQA 223 Query: 236 TEVADFVCYLLSERASYMTGVTTNIAGG 263 E+A V +++ Y+ G + GG Sbjct: 224 EEIASTVRFIIEN--DYVNGRVFEVDGG 249 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 252 Length adjustment: 24 Effective length of query: 243 Effective length of database: 228 Effective search space: 55404 Effective search space used: 55404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory