Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate 7024901 Shewana3_2075 inner-membrane translocator (RefSeq)
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__ANA3:7024901 Length = 405 Score = 187 bits (474), Expect = 5e-52 Identities = 108/268 (40%), Positives = 169/268 (63%), Gaps = 3/268 (1%) Query: 71 VLAAGMTFVILTGGIDLSVGSILSISAVVAMLVSLMPQLGMLSVPAA-LLCGLLFGIVNG 129 +L+ GM+ VI TGGIDLSVG++++I+ V + L+P + +++V AA L+ GLL G +NG Sbjct: 109 LLSIGMSLVIATGGIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIVGLLAGCING 168 Query: 130 ALVAFMKLPPFIVTLGTLTAVRGLARLVGNDSTIYNPDIGFAFIGNGEVLGVPWLVIIAF 189 LV+F+ + P + TL + A RG+A+L+ I GFA IG G+ LG+P V I Sbjct: 169 GLVSFLGIQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQFLGLPMPVWIVI 228 Query: 190 AVVAVSWFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSA 249 ++ S +LR+T LGL I AVG NA+A+R GI + LF Y ++GL A L G++S+A Sbjct: 229 GMLTFSQLLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTA 288 Query: 250 RLYAANGLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSD 309 + ++ G ELDA+ AV++GG + GG S++ ++VGALII L+ +++ G+ Sbjct: 289 DIQGSDANNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPA 348 Query: 310 IWQYIIKGLVIIGAVALDS--YRRKGSA 335 + +IK +VI+ + L S +RR+ SA Sbjct: 349 KFNLLIKAIVILTVLLLQSAKFRRQLSA 376 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 337 Length of database: 405 Length adjustment: 30 Effective length of query: 307 Effective length of database: 375 Effective search space: 115125 Effective search space used: 115125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory