GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruF in Shewanella sp. ANA-3

Align Fructose import permease protein FruF (characterized)
to candidate 7024901 Shewana3_2075 inner-membrane translocator (RefSeq)

Query= SwissProt::Q8G846
         (356 letters)



>lcl|FitnessBrowser__ANA3:7024901 Shewana3_2075 inner-membrane
           translocator (RefSeq)
          Length = 405

 Score =  218 bits (556), Expect = 2e-61
 Identities = 140/344 (40%), Positives = 198/344 (57%), Gaps = 17/344 (4%)

Query: 23  WSIVAFILLVIICTIFQHDFLALSWNSNTGGLAGPLITMLQESARYLMIATGMTLVISTA 82
           W ++A  +L++        F  +S+  +   L G LI +L  SA   +++ GM+LVI+T 
Sbjct: 64  WPLLALSILLLANLFIDSSFFNISYQDDR--LYGSLIDILNRSAPVALLSIGMSLVIATG 121

Query: 83  GIDLSVGSVMAVAGAA-AMQTLSNGMNVWLSILIALAVGLAIGCVNGALVSFLGLQPFIT 141
           GIDLSVG+VMA+AGA  A   L   +++   I   L VGL  GC+NG LVSFLG+QP + 
Sbjct: 122 GIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIVGLLAGCINGGLVSFLGIQPIVA 181

Query: 142 TLIMMLAGRGMAKVITSGENTDASAVAGNEP-LKWFANGFILGIPANFVIAVIIVILVGL 200
           TL++M+AGRG+A++I  G+      +    P       G  LG+P    I + ++    L
Sbjct: 182 TLLLMVAGRGVAQLINQGQ-----IITFQHPGFAAIGVGQFLGLPMPVWIVIGMLTFSQL 236

Query: 201 LCRKTAMGMMIEAVGINQEASRMTGIKPKKILFLVYAISGFLAAIAGLFATASVMRVDVV 260
           L RKTA+G+ IEAVG N +ASR  GI  K I    Y I+G  AA+AG+ +TA +   D  
Sbjct: 237 LLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSDAN 296

Query: 261 KTGQDLEMYAILAVVIGGTSLLGGKFSLAGSAVGAVIIAMIRKTIITLGVNAEATPAFFA 320
             G  LE+ A+LAVVIGG +L GG+FSL  S VGA+II  +  TII  G+ A+      A
Sbjct: 297 NAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNLLIKA 356

Query: 321 VVVIVICVMQAPKI-HNLSANMKRKRALKAQ-------AKAVAA 356
           +V++ + ++Q+ K    LSA  K KR   A+       AKA AA
Sbjct: 357 IVILTVLLLQSAKFRRQLSALFKSKRHADAKPAEKATSAKASAA 400


Lambda     K      H
   0.325    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 347
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 356
Length of database: 405
Length adjustment: 30
Effective length of query: 326
Effective length of database: 375
Effective search space:   122250
Effective search space used:   122250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory