GapMind for catabolism of small carbon sources

 

Alignments for a candidate for gloA in Shewanella sp. ANA-3

Align lactoylglutathione lyase (EC 4.4.1.5) (characterized)
to candidate 7025570 Shewana3_2721 glyoxalase/bleomycin resistance protein/dioxygenase (RefSeq)

Query= BRENDA::Q8ZM36
         (144 letters)



>FitnessBrowser__ANA3:7025570
          Length = 131

 Score =  147 bits (371), Expect = 6e-41
 Identities = 72/126 (57%), Positives = 91/126 (72%)

Query: 19  MIIDRIDHLVLTVSDISTTIRFYEEVLGFSAVTFKQNRKALIFGAQKINLHQQEMEFEPK 78
           M + R+DHLVLTV DI  ++ FY+ VLG     F Q R AL FG QKINLHQ   EFEPK
Sbjct: 1   MRVTRLDHLVLTVKDIEASVDFYQRVLGMKKSVFGQGRIALNFGDQKINLHQAGAEFEPK 60

Query: 79  ASRPTPGSADLCFITSTPINDVVSEILQAGISIVEGPVERTGATGEIMSIYIRDPDGNLI 138
           A+  TPGSADLCF+ S  I +V++ +    ++I+EGPV RTGATG I S+YIRDPD NL+
Sbjct: 61  ANLATPGSADLCFVVSHNIEEVINHLNSLEVAIIEGPVLRTGATGRINSVYIRDPDLNLL 120

Query: 139 EISQYV 144
           E+S+Y+
Sbjct: 121 ELSEYL 126


Lambda     K      H
   0.321    0.137    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 65
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 144
Length of database: 131
Length adjustment: 15
Effective length of query: 129
Effective length of database: 116
Effective search space:    14964
Effective search space used:    14964
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory