Align glycine C-acetyltransferase (EC 2.3.1.29) (characterized)
to candidate 7025358 Shewana3_2518 aminotransferase, class I and II (RefSeq)
Query= BRENDA::P0AB77 (398 letters) >FitnessBrowser__ANA3:7025358 Length = 406 Score = 197 bits (502), Expect = 3e-55 Identities = 129/383 (33%), Positives = 200/383 (52%), Gaps = 19/383 (4%) Query: 19 EGLFKEERIITSAQQADITVADG-------SHVINFCANNYLGLANHPDLIAAAKAGMDS 71 +GL ++ + ++SA DG H +NF +N+YLGL+ P L+ A + G Sbjct: 23 QGLLRQRQALSSAVALS---EDGPQFGLAEQHYLNFSSNDYLGLSRAPALVEALRLGAKQ 79 Query: 72 HGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIIS 131 +G G + + G ++H LE KL G E A+L+SS F AN L +TL +D +++ Sbjct: 80 YGVGSGASPLVTGYSEAHLALETKLCQITGFEAALLFSSGFSANTTLCKTLFDKQDVVLA 139 Query: 132 DALNHASIIDGVRLCKAKRYRYANNDMQELEARL-KEAREAGARHVLIATDGVFSMDGVI 190 D L HASIIDG+R A R+ +N + E L K A A + T+ VFSMDG I Sbjct: 140 DKLVHASIIDGLRDSGADFKRFLHNSTESAERLLAKNAVSA------LITESVFSMDGDI 193 Query: 191 ANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGGAS 250 A + + L ++A ++VDD+H G V + E +DI T GKAL G Sbjct: 194 APISALSALCRAHNAWLIVDDAHGFGVV-DAVSVQAESTPASNLIDIQIVTFGKAL-GCQ 251 Query: 251 GGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFR 310 G ++++E+L +R Y++S +L+PA A ++ +E EA EL+ +L N F+ Sbjct: 252 GAAILGCRQLIEFLVSNAREYIYSTALSPANAALALAAVEYTEAHPELKQKLQRNILLFK 311 Query: 311 EQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQ 370 + A L G+D AI P+++GDA + A +L+ GI+V P VP G AR+R Sbjct: 312 QLCQDADIPLLGSDTAIQPLIIGDATQTMRVAEKLKALGIWVGAIRPPTVPVGSARLRIT 371 Query: 371 MSAAHTPEQITRAVEAFTRIGKQ 393 +SA+H+ I V + + K+ Sbjct: 372 LSASHSEAVIRCCVSSIATVLKE 394 Lambda K H 0.320 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 406 Length adjustment: 31 Effective length of query: 367 Effective length of database: 375 Effective search space: 137625 Effective search space used: 137625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory