GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ackA in Shewanella sp. ANA-3

Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate 7026055 Shewana3_3197 phosphoribosylglycinamide formyltransferase 2 (RefSeq)

Query= SwissProt::P33221
         (392 letters)



>lcl|FitnessBrowser__ANA3:7026055 Shewana3_3197
           phosphoribosylglycinamide formyltransferase 2 (RefSeq)
          Length = 391

 Score =  527 bits (1358), Expect = e-154
 Identities = 264/389 (67%), Positives = 315/389 (80%), Gaps = 1/389 (0%)

Query: 3   LLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINML 62
           ++GT     A R MLLG GELGKEVAIE QRLGVEVI VDRY +APAM +AHRSHVINML
Sbjct: 1   MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAHRSHVINML 60

Query: 63  DGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTMNREGIRRLAA 122
           D  ALR ++ELEKPH ++PEIEAIAT  L+++E EGLNVVP ARAT+LTM+REGIRRLAA
Sbjct: 61  DAKALRAIIELEKPHLVIPEIEAIATQTLVEMETEGLNVVPTARATQLTMDREGIRRLAA 120

Query: 123 EELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQ 182
           E L LPTS Y F D+E+ F +A+  IG PC+VKPVMSSSGKGQ+ IR A Q  +AW+YAQ
Sbjct: 121 ETLGLPTSPYFFCDTETEFNQAIGKIGVPCVVKPVMSSSGKGQSVIRDAAQSTKAWQYAQ 180

Query: 183 QGGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMSPL 242
           +GGRAG GRVIVEG + FD+EITLLT+SAV+G+HFCAP+GHRQEDGDYRESWQPQ MS  
Sbjct: 181 EGGRAGGGRVIVEGFIPFDYEITLLTISAVNGIHFCAPIGHRQEDGDYRESWQPQAMSAD 240

Query: 243 ALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEFAL 302
            L ++Q IA KVV ALGGYGLFGVELFV G +V FSEVSPRPHDTG+VTLISQDLSEFAL
Sbjct: 241 VLAKSQAIASKVVEALGGYGLFGVELFVKGSDVYFSEVSPRPHDTGLVTLISQDLSEFAL 300

Query: 303 HVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVGAD-LQIRLFGKPEIDGS 361
           HVRA LGLP+  I Q+GP+ASAV+L +  S+N+ +  + +A+ A+  Q+RLF KPEIDG 
Sbjct: 301 HVRAILGLPIPNIHQHGPSASAVVLVEGKSKNIRYQGLADALAAENTQLRLFAKPEIDGR 360

Query: 362 RRLGVALATAESVVDAIERAKHAAGQVKV 390
           RRLGVALA  + +  A+ +A  +A +VKV
Sbjct: 361 RRLGVALARDKDIESAVNKALDSASKVKV 389


Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 471
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 392
Length of database: 391
Length adjustment: 31
Effective length of query: 361
Effective length of database: 360
Effective search space:   129960
Effective search space used:   129960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory