GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoA in Shewanella sp. ANA-3

Align thymidine phosphorylase (EC 2.4.2.4) (characterized)
to candidate 7023822 Shewana3_1042 thymidine phosphorylase (RefSeq)

Query= BRENDA::P07650
         (440 letters)



>lcl|FitnessBrowser__ANA3:7023822 Shewana3_1042 thymidine
           phosphorylase (RefSeq)
          Length = 443

 Score =  603 bits (1554), Expect = e-177
 Identities = 297/438 (67%), Positives = 354/438 (80%)

Query: 1   MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT 60
           MFLAQEIIRKKR+G ALS EEI+FF+ GI  N +SEGQIAAL M ++F+DM M ER++LT
Sbjct: 1   MFLAQEIIRKKRNGLALSTEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALT 60

Query: 61  MAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT 120
            AMRDSGTVL+W+SL LNGP++DKHSTGGVGDV SLMLGPM AACGGY+PMISGRGLGHT
Sbjct: 61  TAMRDSGTVLNWQSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT 120

Query: 121 GGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI 180
           GGTLDK ++IPG+   P    FR+++KDVGVAIIGQT  L PADKRFY+ RD TATV+SI
Sbjct: 121 GGTLDKFDAIPGYQTEPSSELFRKVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESI 180

Query: 181 PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT 240
            LITASIL+KKLA  LDAL MDVKVGSGAFMPTYE SE LA +I  VANGAG +TTALLT
Sbjct: 181 SLITASILSKKLACSLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT 240

Query: 241 DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL 300
           DMNQVLAS AGNAVEV+EA+ FLTG YRNPRL+ VTM LC EML+ G LA D+A+ARAKL
Sbjct: 241 DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYAVTMGLCAEMLLLGGLASDEADARAKL 300

Query: 301 QAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMDTRALG 360
             VLDNG+AAE+FG+MV+   GP DFVENY+KYLP + + + V+ADT+G+   MDTR LG
Sbjct: 301 NRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAYSMDTRELG 360

Query: 361 MAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIHAKDENNWQEAAKAVKAA 420
           +AVV +GGGRR+  D +DYSVG T +  LGD++D   P+AVIHA+ E  + +A +AVK A
Sbjct: 361 LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKIDASTPIAVIHAQSEEAFAQAEEAVKKA 420

Query: 421 IKLADKAPESTPTVYRRI 438
           I + + APE TP +Y  I
Sbjct: 421 IHIDEVAPEKTPEIYAYI 438


Lambda     K      H
   0.318    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 569
Number of extensions: 9
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 440
Length of database: 443
Length adjustment: 32
Effective length of query: 408
Effective length of database: 411
Effective search space:   167688
Effective search space used:   167688
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate 7023822 Shewana3_1042 (thymidine phosphorylase (RefSeq))
to HMM TIGR02643 (deoA: thymidine phosphorylase (EC 2.4.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02643.hmm
# target sequence database:        /tmp/gapView.19665.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02643  [M=437]
Accession:   TIGR02643
Description: T_phosphoryl: thymidine phosphorylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   2.5e-222  724.4   4.5   2.9e-222  724.2   4.5    1.0  1  lcl|FitnessBrowser__ANA3:7023822  Shewana3_1042 thymidine phosphor


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7023822  Shewana3_1042 thymidine phosphorylase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  724.2   4.5  2.9e-222  2.9e-222       1     437 []       2     438 ..       2     438 .. 1.00

  Alignments for each domain:
  == domain 1  score: 724.2 bits;  conditional E-value: 2.9e-222
                         TIGR02643   1 llpqeiirkkrdglslsdeeiaafvegvtddsvsegqiaalamavyfngleldekvaltlamrdsGdvldwkdldln 77 
                                       +l+qeiirkkr+gl+ls+eei+ fv+g+t ++vsegqiaal mavyfn++++de++alt amrdsG+vl+w++l ln
  lcl|FitnessBrowser__ANA3:7023822   2 FLAQEIIRKKRNGLALSTEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALTTAMRDSGTVLNWQSLGLN 78 
                                       79*************************************************************************** PP

                         TIGR02643  78 gPvvdkhstGGvGdvvslmlaPivaacGgyvPmisGrGlGhtGGtldkleaiPGydvaPdeelfrkvvkdvGvaiiG 154
                                       gPv+dkhstGGvGdv+slml+P+ aacGgyvPmisGrGlGhtGGtldk++aiPGy++ P++elfrkvvkdvGvaiiG
  lcl|FitnessBrowser__ANA3:7023822  79 GPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFRKVVKDVGVAIIG 155
                                       ***************************************************************************** PP

                         TIGR02643 155 qtadlaPadkrlyairdvtatvesiplitasilskklaaGldalvldvkvGnGafmesleeseelarslvevangaG 231
                                       qt+dl Padkr+y+ird tatvesi+litasilskkla  ldal++dvkvG+Gafm+++e seelars+  vangaG
  lcl|FitnessBrowser__ANA3:7023822 156 QTGDLVPADKRFYSIRDNTATVESISLITASILSKKLACSLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAG 232
                                       ***************************************************************************** PP

                         TIGR02643 232 vrttalitdmnqalasaaGnavevreavdfltGekrdkrleevtlalaaellvsgklaadeaeaeakleavlesGra 308
                                        +ttal+tdmnq+las+aGnavev+ea+dfltG++r++rl +vt+ l+ae+l+ g+la+dea+a+akl++vl++Gra
  lcl|FitnessBrowser__ANA3:7023822 233 TKTTALLTDMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYAVTMGLCAEMLLLGGLASDEADARAKLNRVLDNGRA 309
                                       ***************************************************************************** PP

                         TIGR02643 309 aerfarmvaalgGPadfvekpekylakaaiakavkaaregylseidtrelGlavvalGGGrrkaddkldlsvGltdl 385
                                       ae+f++mv+ lgGP dfve+++kyl++++i+++v a+++gy  ++dtrelGlavv+lGGGrrk+ d ld+svGlt++
  lcl|FitnessBrowser__ANA3:7023822 310 AEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAYSMDTRELGLAVVTLGGGRRKPGDALDYSVGLTQV 386
                                       ***************************************************************************** PP

                         TIGR02643 386 lelGekvekeeplavvhaadeedaeeaakavkkalkiadeaPeeakvvleri 437
                                         lG+k+++ +p+av+ha++ee +++a +avkka++i++ aPe+++ +++ i
  lcl|FitnessBrowser__ANA3:7023822 387 CALGDKIDASTPIAVIHAQSEEAFAQAEEAVKKAIHIDEVAPEKTPEIYAYI 438
                                       **********************************************999865 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (437 nodes)
Target sequences:                          1  (443 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.02s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 7.35
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory