GapMind for catabolism of small carbon sources

 

Aligments for a candidate for treEIIA in Shewanella sp. ANA-3

Align trehalose-specific PTS system, I, HPr, and IIA components (characterized)
to candidate 7025094 Shewana3_2257 phosphoenolpyruvate--protein phosphotransferase (RefSeq)

Query= reanno::pseudo3_N2E3:AO353_15995
         (844 letters)



>lcl|FitnessBrowser__ANA3:7025094 Shewana3_2257
           phosphoenolpyruvate--protein phosphotransferase (RefSeq)
          Length = 567

 Score =  296 bits (759), Expect = 2e-84
 Identities = 201/570 (35%), Positives = 301/570 (52%), Gaps = 25/570 (4%)

Query: 277 LRGVCASAGSAFGYVVQV--AERTLE---MPEFAADQQLER-----ESLERALMHATQAL 326
           + G+  S+G AFG  + +  AE  L+   +P     QQ  +     ++L++ L H+   L
Sbjct: 3   ITGIIVSSGIAFGQALHLTQAEHHLDYRPIPLSRIPQQQSKFVKALQALQQQLSHSQTKL 62

Query: 327 QRLRDNAAGEAQADIFKAHQELLEDPSLLEQAQALIAEGK-SAAFAWNSATEATATLFKS 385
               +N        + +A   LLED  L++Q +  I   + SA+ A        A   +S
Sbjct: 63  DPQSENY------QLIEADLLLLEDEELIDQVKEAIRTLQLSASVAVERIFAHQANELES 116

Query: 386 LGSTLLAERALDLMDVGQRVLKLILGVPD-GVWELPDQAILIAEQLTPSQTAALDTGKVL 444
           L    LA RA D+  +GQR++  I G  D G+ +L +  IL+A+ LTP++ A L   ++ 
Sbjct: 117 LDDPYLANRAQDVRCLGQRLVTAINGRLDQGLAQLTEPTILLAQDLTPAEFALLPKEQLS 176

Query: 445 GFATVGGGATSHVAILARALGLPAVCGLPLQVLSLASGTRVLLDADKGELHLDPAVSVIE 504
           G     GG TSH AILARA G+PA+         + +GT ++LDA  GEL ++PA  +  
Sbjct: 177 GIVLKTGGLTSHTAILARAAGIPAILSCQFDAEFIPNGTPLVLDALSGELFVNPAPELQA 236

Query: 505 QLHAKRQQQRQRHQHELENAARAAVTRDGHHFEVTANVASLAETEQAMSLGAEGIGLLRS 564
           +L      ++ R           A T+DGH   + ANV +L +      +GA+GIGL R+
Sbjct: 237 RLTVTLHHEQARRAALQAYRDVPAKTQDGHLVGLMANVGNLNDITHVGDVGADGIGLFRT 296

Query: 565 EFLYQQRSVAPSHDEQAGTYSAIARALGPQRNLVVRTLDVGGDKPLAYVPMDSEANPFLG 624
           EF+    S  P    Q   Y     ALG  +   +RTLD+G DK L  +  + E NP LG
Sbjct: 297 EFMLMHTSTLPDEKAQYNLYCEALHALGG-KTFTIRTLDIGADKELPCLCQEVEDNPALG 355

Query: 625 MRGIRLCLERPQLLREQFRAILSSAGLARLHIMLPMVSQLSELRLARLMLEEEALAL--- 681
           +RG+R  L  P+L + Q RAIL +A    + +M PMV+Q+ EL     ++ E   AL   
Sbjct: 356 LRGVRYTLAHPELFKTQLRAILRAANHGPIRLMFPMVNQVEELDQIFALIAECQDALEEE 415

Query: 682 --GLRELPKLGIMIEVPAAALMADLFAPEVDFFSIGTNDLTQYTLAMDRDHPRLASQADS 739
             G  EL   GI++E PAA +      P +DF SIGTNDLTQY +A DR +P+L     S
Sbjct: 416 EKGFGEL-SYGIVVETPAAVMNLASMLPRLDFVSIGTNDLTQYAMAADRTNPQLTRDYPS 474

Query: 740 FHPSVLRLIASTVKAAHAHGKWVGVCGALASETLAVPLLLGLGVDELSVSVPLIPAIKAA 799
             P++L LI  TV  A A G  V +CG LAS  L VPLL+G+G+DELSV++  +  +KAA
Sbjct: 475 LSPAILGLIKMTVDQAKAAGVKVSLCGELASSPLMVPLLIGMGLDELSVNLSALLEVKAA 534

Query: 800 IREVELSDCQAIAHQVLGLESAEQVREALS 829
           + + +L+   A+AH  +      ++++ ++
Sbjct: 535 VCQGQLTKFSALAHTAMQQNRISELQQCIT 564


Lambda     K      H
   0.318    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1003
Number of extensions: 48
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 844
Length of database: 567
Length adjustment: 39
Effective length of query: 805
Effective length of database: 528
Effective search space:   425040
Effective search space used:   425040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory