Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate 7026050 Shewana3_3192 sulfate ABC transporter, ATPase subunit (RefSeq)
Query= uniprot:P70970 (276 letters) >FitnessBrowser__ANA3:7026050 Length = 376 Score = 125 bits (313), Expect = 2e-33 Identities = 78/221 (35%), Positives = 122/221 (55%), Gaps = 20/221 (9%) Query: 9 ALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLK 68 AL +N I+EG + ++G +GSGK+TLL+ + GL GQI G N+D+ Sbjct: 17 ALSPLNLDIQEGEMIGLLGPSGSGKTTLLRIIAGLEGADSGQIHFG---------NRDVT 67 Query: 69 KLR---KKVGIVFQFPEHQLFEE-TVLKDISFG----PMNFGVKKEDAEQKAREMLQLVG 120 ++ ++VG VFQ + LF TV +++FG P K + +++ +L++V Sbjct: 68 QVHVRDRRVGFVFQ--NYALFRHMTVADNVAFGLEVIPKKQRPSKAEIQKRVSHLLEMVQ 125 Query: 121 LSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQ 180 L L R P +LSGGQ +R+A+A LA PEVL+LDEP LD + RKE+ LH Sbjct: 126 LGH-LAQRYPEQLSGGQKQRIALARALATQPEVLLLDEPFGALDAKVRKELRRWLRSLHD 184 Query: 181 RGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLF 221 T++ VTH ++A +D ++VM G I+ +P +L+ Sbjct: 185 ELKFTSVFVTHDQDEALELSDRVVVMSNGNIEQVNTPIELY 225 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 376 Length adjustment: 28 Effective length of query: 248 Effective length of database: 348 Effective search space: 86304 Effective search space used: 86304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory