Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate 7024901 Shewana3_2075 inner-membrane translocator (RefSeq)
Query= uniprot:A0A1N7UKA9 (325 letters) >FitnessBrowser__ANA3:7024901 Length = 405 Score = 165 bits (417), Expect = 2e-45 Identities = 101/310 (32%), Positives = 183/310 (59%), Gaps = 15/310 (4%) Query: 21 SLDRFGLPLVF--ILLCVVMAFSSEYF-------MTWRNWMDILRQTSINGILAVGMTYV 71 S+ R+ PL+ ILL + S +F + + +DIL +++ +L++GM+ V Sbjct: 58 SMGRYLWPLLALSILLLANLFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSIGMSLV 117 Query: 72 ILTKGIDLSVGSILAFAG-LCSAMVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIP 130 I T GIDLSVG+++A AG +C+ ++ L+ ++AG+ G + G +NG +V+ L I Sbjct: 118 IATGGIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIVGLLAGCINGGLVSFLGIQ 177 Query: 131 PFVATLGMLSIARGMTFILNDGSPITDLPDAYLALGIGKIGPIGVPIIIFAVVALIFW-- 188 P VATL ++ RG+ ++N G IT + A+G+G+ +G+P+ ++ V+ ++ + Sbjct: 178 PIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQF--LGLPMPVWIVIGMLTFSQ 235 Query: 189 MVLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTT-SAL 247 ++LR T G ++ AVG N K++R GI + + Y ++GL A LAG++ +A S Sbjct: 236 LLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSDA 295 Query: 248 PQAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAK 307 AG+ ELDA+ AVVIGG +L+GG S++ ++ GAL+I + + + G+ + + + K Sbjct: 296 NNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNLLIK 355 Query: 308 GLIIVFAVLI 317 ++I+ +L+ Sbjct: 356 AIVILTVLLL 365 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 405 Length adjustment: 29 Effective length of query: 296 Effective length of database: 376 Effective search space: 111296 Effective search space used: 111296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory