Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate 7024902 Shewana3_2076 inner membrane ABC transporter permease protein YjfF (RefSeq)
Query= TCDB::Q9WXW7 (317 letters) >FitnessBrowser__ANA3:7024902 Length = 320 Score = 115 bits (287), Expect = 2e-30 Identities = 86/278 (30%), Positives = 145/278 (52%), Gaps = 18/278 (6%) Query: 44 RQIAIFGLLAIGETFVIISGGGAIDLSPGSMVALTGVMVAWLMTHGVPVW---ISVILIL 100 R A + A+G T VIISGG IDLS G+++AL+GV+ + L+T W ++ ++IL Sbjct: 41 RDNAFLLITALGMTLVIISGG--IDLSVGAVIALSGVVTSLLITEYQ--WHPLLAFVVIL 96 Query: 101 LFSIGAGAWHGLFVTKLRVPAFIITLGTLTIARGMAAVITKGWPIIGLP-------SSFL 153 GA G + ++ FI+TL + +ARG+A +++ I P S Sbjct: 97 PLGTLFGALMGTIIHVYKLQPFIVTLAGMFLARGLATTLSEESIAIDHPFYDAVAEMSIA 156 Query: 154 KIGQGEFLKIPIPVWILLAVALVADFFLRKTVYGKHLRASGGNEVAARFSGVNVDRVRMI 213 G G L + ++IL V + + T +G ++ A GGN+ +A G+++ + + Sbjct: 157 LPGNGA-LDLSSLIFILFFVIIAV--VMHYTRFGTNVYAIGGNQHSAELMGISIAKTTIS 213 Query: 214 AFMVSGFLAGVVGIIIAARLSQGQPGVGSMYELYAIASTVIGGTSLTGGEGSVLGAIVGA 273 + +S FLA + GI+ G EL AIA+ VIGGT LTGG G VLG ++G Sbjct: 214 IYAISSFLATLAGIVFTFYTFSGYALGAIGVELDAIAAVVIGGTLLTGGSGFVLGTVLGV 273 Query: 274 SIISLLWNALVL-LNVSTYWHNVVIGIVIVVAVTLDIL 310 ++ ++ + ++S++W +VIG+++ + L L Sbjct: 274 ILMGVIQTYITFDGSLSSWWTKIVIGLLLFFFILLQKL 311 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 320 Length adjustment: 27 Effective length of query: 290 Effective length of database: 293 Effective search space: 84970 Effective search space used: 84970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory