GapMind for catabolism of small carbon sources

 

Protein BPHYT_RS22740 in Burkholderia phytofirmans PsJN

Annotation: BPHYT_RS22740 ABC transporter permease

Length: 328 amino acids

Source: BFirm in FitnessBrowser

Candidate for 13 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-fructose catabolism frcC hi Fructose import permease protein FrcC (characterized) 45% 84% 265 Ribose import permease protein RbsC 39% 210.7
D-mannose catabolism frcC hi Fructose import permease protein FrcC (characterized) 45% 84% 265 Ribose import permease protein RbsC 39% 210.7
D-ribose catabolism frcC hi Fructose import permease protein FrcC (characterized) 45% 84% 265 Ribose import permease protein RbsC 39% 210.7
sucrose catabolism frcC hi Fructose import permease protein FrcC (characterized) 45% 84% 265 Ribose import permease protein RbsC 39% 210.7
D-cellobiose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 206.1 Fructose import permease protein FrcC 45% 265.0
D-glucose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 206.1 Fructose import permease protein FrcC 45% 265.0
lactose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 206.1 Fructose import permease protein FrcC 45% 265.0
D-maltose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 206.1 Fructose import permease protein FrcC 45% 265.0
sucrose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 206.1 Fructose import permease protein FrcC 45% 265.0
trehalose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 206.1 Fructose import permease protein FrcC 45% 265.0
D-xylose catabolism xylH lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 206.1 Fructose import permease protein FrcC 45% 265.0
myo-inositol catabolism PS417_11895 lo Inositol transport system permease protein (characterized) 34% 98% 190.7 Fructose import permease protein FrcC 45% 265.0
2'-deoxyinosine catabolism H281DRAFT_01112 lo deoxynucleoside transporter, permease component 2 (characterized) 30% 93% 148.7 Fructose import permease protein FrcC 45% 265.0

Sequence Analysis Tools

View BPHYT_RS22740 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MSTPSAPAGHSRSFAERMPSLAEVGPLIALVLACGFFISQSSRFLSFQNLSLILQQTMVV
AVIAIGQTLIVLTGGIDLSCGMVMAFGSIIMTKFAVTLGVPPVLAILCGVGASALFGALN
GVLITRIKLPAFIVTLGTLNIAFALTQIYSNAESVSNLPDAIMFLGNTFKLGPADVTYGT
VLTLLMYLATWFVLRDTVPGRHLYALGNNPEAARLMGLSSQKILLTVYSLAGAIYGIAAL
LSVSRTGVGDPQAGQTENLDSITAVVLGGTSLFGGRGSISGTLLGALIVGVFRNGLTLIG
VSSVYQVLITGMLVILAVAADKLSHRRG

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory