GapMind for catabolism of small carbon sources

 

Protein BPHYT_RS32510 in Burkholderia phytofirmans PsJN

Annotation: FitnessBrowser__BFirm:BPHYT_RS32510

Length: 286 amino acids

Source: BFirm in FitnessBrowser

Candidate for 17 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-isoleucine catabolism livH med branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized) 33% 96% 163.3 D-lactate transporter, permease component 2 39% 163.3
L-leucine catabolism livH med branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized) 33% 96% 163.3 D-lactate transporter, permease component 2 39% 163.3
L-phenylalanine catabolism livH med branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized) 33% 96% 163.3 D-lactate transporter, permease component 2 39% 163.3
L-valine catabolism livH med branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized) 33% 96% 163.3 D-lactate transporter, permease component 2 39% 163.3
L-proline catabolism HSERO_RS00885 lo ABC transporter permease (characterized, see rationale) 32% 98% 162.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-serine catabolism Ac3H11_1695 lo ABC transporter permease (characterized, see rationale) 32% 98% 162.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-tyrosine catabolism Ac3H11_1695 lo ABC transporter permease (characterized, see rationale) 32% 98% 162.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-alanine catabolism braD lo NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 33% 99% 154.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-isoleucine catabolism natD lo NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 33% 99% 154.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-leucine catabolism natD lo NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 33% 99% 154.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-proline catabolism natD lo NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 33% 99% 154.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-serine catabolism braD lo NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 33% 99% 154.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-threonine catabolism braD lo NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 33% 99% 154.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-valine catabolism natD lo NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 33% 99% 154.5 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
D-alanine catabolism AZOBR_RS08235 lo L-proline and D-alanine ABC transporter, permease component 1 (characterized) 31% 98% 151.8 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-proline catabolism AZOBR_RS08235 lo L-proline and D-alanine ABC transporter, permease component 1 (characterized) 31% 98% 151.8 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3
L-histidine catabolism natD lo NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 97% 141 branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) 33% 163.3

Sequence Analysis Tools

View BPHYT_RS32510 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNVYLLQIVNGIGVGMLYFLLAVGLSIVFGLLRFVNFAHGAFYLLGAYFCYQAMQWSMSF
WTALVVVPVVVGALAWVVEKLILRHVYAQQHEFHILVTVGLALVVQECAILIWGPLGDNV
AVPDVLNGVVIWGSFVYPKYRLFVIGFTAVLAALLWWVLEGTRLGSAVRAGSESTEMVSL
LGINVLRVFSLVFALGAATAALAGVLAAPIRGVDPFMGIEALSVAFVVVVVGGMGNFLGA
LVGGLLVGIVQSVMSTLWPEGARLMIYVAMAAVLLLRPNGLLGRAA

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory