Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate BPHYT_RS29430 BPHYT_RS29430 major facilitator transporter
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >FitnessBrowser__BFirm:BPHYT_RS29430 Length = 433 Score = 273 bits (698), Expect = 8e-78 Identities = 150/408 (36%), Positives = 228/408 (55%), Gaps = 5/408 (1%) Query: 27 SIFSGSVGNMVEWYDWYVYAAFSLYFAKAFFPKGDTTAQLLNTAAIFAVGFLMRPIGGWL 86 +I + +GN +E++D+ VY F++ K +FP D T LL + A FA GF+ RP+G + Sbjct: 21 AIAAAVIGNWLEFFDFTVYGFFAVIIGKLYFPSADPTTSLLLSVATFAAGFITRPLGSVM 80 Query: 87 MGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETIGVGAPILLVFARLLQGLSVGGEY 146 +G+YADR GRKAAL ++ LM + +IA++P Y IG+ AP+L+VFARL+QG S GGE+ Sbjct: 81 LGVYADRKGRKAALNLTIMLMAVSTGLIAIAPTYAQIGLAAPLLIVFARLVQGFSQGGEF 140 Query: 147 GTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQTLTTEQLYDWGWRIPFA 206 G + + L E RRGF +S+Q T L+ G+ L L + L WGWRIPF Sbjct: 141 GAATSTLLEQGGGTRRGFRASWQLATQGGAALMGSGIAAALSGALPKDSLESWGWRIPFL 200 Query: 207 IGALCAIVALYLRRGMEETESFAKKEKSKESAMRTLL-RHPKELMTVVGLTMGGTLAFYT 265 +G L A V +YLRR + + + A + + L +H + L+ + MGGT++ Y Sbjct: 201 LGVLIAPVGMYLRRRLADDAASAHSHAIERGVLHELFTQHVRTLVLITLTVMGGTVSTYI 260 Query: 266 YTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQPIIGGLSDKVG--RRPILIAFGILG 323 T YM Y ++T+G+ +S S + A F+ + P+ G LSD++G +RPIL G+L Sbjct: 261 LTFYMPTYAIHTLGLPMSLSMLVGVAAGFVMLITCPLFGMLSDRIGSRKRPILFGRGVL- 319 Query: 324 TLFTVPILTTLHTIQTWWGAFFLIMAALIIVSGYTSINAVVKAELFPTEIRALGVGLPYA 383 L P ++ L L+ S ++ + E FP +RA G+ + YA Sbjct: 320 VLLLFPAFMLINRFPQLPVIMSLTALMLLFYSMGSASEFALMCESFPRRVRATGISIAYA 379 Query: 384 LTVSIFGGTAEYIALW-FKSIGMETGYYWYVTACIAVSLLVYVTMKDT 430 L+V +FGGTA+ +A W K G + YV AC+ VSL+ +K+T Sbjct: 380 LSVCVFGGTAQLVATWLIKLTGSKLAPAGYVAACVVVSLIAVSMLKET 427 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 527 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 433 Length adjustment: 32 Effective length of query: 407 Effective length of database: 401 Effective search space: 163207 Effective search space used: 163207 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory