Align BadH (characterized)
to candidate BPHYT_RS30440 BPHYT_RS30440 short-chain dehydrogenase
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__BFirm:BPHYT_RS30440 Length = 254 Score = 175 bits (443), Expect = 9e-49 Identities = 102/256 (39%), Positives = 149/256 (58%), Gaps = 12/256 (4%) Query: 4 LQNKTAVITGGGG--GIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVR 61 L K AVI+GG GIG AT R+FA GA+IA+FDL+ AA + A +I G Sbjct: 7 LDGKVAVISGGASPRGIGMATARKFAAHGARIAIFDLDEKAAVEAAASI---GPEHRGYV 63 Query: 62 CDIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHM 121 C++ DR + AA+ T G +DIL+NNAG F +P W+R++ +NL G L++ Sbjct: 64 CNVTDRGACQAAVERTVADFGSIDILINNAGITQAAKFLDIDPESWDRILDVNLRGVLYL 123 Query: 122 HHAVLPGMVERRHGRIVNIASDAARVGSS--GEAVYAACKGGLVAFSKTLAREHARHGIT 179 AV+P M +++ G I ++S +A+ G G Y+A K G++ +K +ARE GI Sbjct: 124 SQAVVPQMKKQKSGSIGCMSSVSAQRGGGILGGPHYSAAKAGVLGLAKAMARELGNDGIR 183 Query: 180 VNVVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGF 239 VN V PG T D+ +G + +K +E + IPL RLG PDD+AGA F SD + + Sbjct: 184 VNCVTPGLIQT----DINAGKISDDKRVEILS-GIPLNRLGVPDDVAGAFLFLASDLSSY 238 Query: 240 ITGQVLSVSGGLTMNG 255 ITG V+ V+GG+ ++G Sbjct: 239 ITGAVIDVNGGMLIHG 254 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 254 Length adjustment: 24 Effective length of query: 231 Effective length of database: 230 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory