Align BadI (characterized)
to candidate BPHYT_RS28620 BPHYT_RS28620 enoyl-CoA hydratase
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__BFirm:BPHYT_RS28620 Length = 260 Score = 129 bits (323), Expect = 8e-35 Identities = 90/254 (35%), Positives = 126/254 (49%), Gaps = 14/254 (5%) Query: 10 IRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFCTGGDQS 69 I + +A I +NRP+K NA ELI+AL + D +V A+VL G+G + FC GGD Sbjct: 10 ITSRIATITLNRPEKRNAISDDMRTELIEALNRVSTDPEVRAVVLTGSG-KGFCAGGDVG 68 Query: 70 THDGNYDG-RGTVGLP----MEELHTAIR---DVPKPVIARVQGYAIGGGNVLATICDLT 121 + G V + +H + +PKP IA V G A G G +A CD Sbjct: 69 GMAKRMEAPAGEVAFNGWSRQQRVHHTVNLLFSMPKPTIAAVNGAAAGLGADMALSCDFV 128 Query: 122 ICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANLC 181 + SE+A F K G + G G FL R VG +A+E+ + ++ EA A+G+A+ Sbjct: 129 VASEEASFAWSYIKRGLIPDGGGMYFLPRRVGLSRAKELIFSGRKVEAPEALALGIADRV 188 Query: 182 VPHDELDAEVQKWGEELCERSPTALAIAKRSFNMD---TAHQAGIAGMGMYALKLYYDTD 238 D L A+ Q W EEL + SPTALA+ K N +AHQ + G A + Y + Sbjct: 189 SRSDALLADAQAWAEELAQGSPTALALGKSILNQSYELSAHQ--VFAQGSQAQAVCYTSH 246 Query: 239 ESREGVKALQEKRK 252 E RE V A K + Sbjct: 247 EHRESVLAFLNKSR 260 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 260 Length adjustment: 24 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory