GapMind for catabolism of small carbon sources

 

Aligments for a candidate for boxB in Burkholderia phytofirmans PsJN

Align Benzoyl-CoA oxygenase component B; Benzoyl-CoA 2,3-dioxygenase subunit B; Benzoyl-CoA dioxygenase oxygenase component; EC 1.14.13.208 (characterized)
to candidate BPHYT_RS13340 BPHYT_RS13340 benzoyl-CoA oxygenase

Query= SwissProt::Q9AIX7
         (473 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS13340 BPHYT_RS13340 benzoyl-CoA
           oxygenase
          Length = 475

 Score =  727 bits (1877), Expect = 0.0
 Identities = 344/472 (72%), Positives = 396/472 (83%)

Query: 2   INYSERIPNNVNLNENKTLQRALEQWQPSFLNWWDDMGPENSSNYDVYLRTAVSVDPKGW 61
           INYSE+IPNNVNL +++ LQRALEQWQP+FL WW DMGPE S  YDVYLRTAVSVD  GW
Sbjct: 4   INYSEKIPNNVNLADDRALQRALEQWQPNFLAWWGDMGPEGSHGYDVYLRTAVSVDAGGW 63

Query: 62  ADFGYVKMHDYRWGIFLAPQEGEKKITFGEHKGQDVWQEVPGEYRSTLRRIIVTQGDTEP 121
           A F +VKM DYRWGIFL P E ++KI FGEHKG+  WQ+VPGE+R+ LRRIIVTQGDTEP
Sbjct: 64  AHFDHVKMPDYRWGIFLTPGEQDRKIHFGEHKGEAAWQDVPGEHRANLRRIIVTQGDTEP 123

Query: 122 ASVEQQRHLGLTAPSLYDLRNLFQVNVEEGRHLWAMVYLLHAHFGRDGREEGEALLERRS 181
           ASVEQQRHLGLTAPS+YDLRNLFQVNVEEGRHLWAMVYLLH +FGRDGREE EALL RRS
Sbjct: 124 ASVEQQRHLGLTAPSMYDLRNLFQVNVEEGRHLWAMVYLLHRYFGRDGREEAEALLGRRS 183

Query: 182 GDEDNPRILTAFNEKTPDWLSFFMFTFITDRDGKFQLASLAESAFDPLARTCKFMLTEEA 241
           GD+DNPRIL AFNEKTPDWL+FFMFT+ TDRDGKFQL++LAES FDPLART +FMLTEEA
Sbjct: 184 GDDDNPRILGAFNEKTPDWLAFFMFTYFTDRDGKFQLSALAESGFDPLARTTRFMLTEEA 243

Query: 242 HHLFVGESGIARVIQRTCEVMKELGTDDPAKLRAAGVIDLPTLQKYLNFHYSVTSDLYGA 301
           HH+FVGESG++RVIQRT +VM ELGTDD +KLRAAGVIDLPT+Q+YLNFHYSVT DL+GA
Sbjct: 244 HHMFVGESGVSRVIQRTAQVMNELGTDDVSKLRAAGVIDLPTIQRYLNFHYSVTIDLFGA 303

Query: 302 EISSNAATYYTNGLKGRFEEEKIGDDHKLQNSEYEVMDVAGDKILTRHVPALSALNERLR 361
           + SSNAAT+Y++GLKGR+EE K  DDH+L    Y+++DV   K++ R VP L+A+NE LR
Sbjct: 304 DHSSNAATFYSSGLKGRYEENKRDDDHQLNGQSYKLLDVQDGKLVEREVPMLNAMNEVLR 363

Query: 362 DDWITDVQAGVDRWNRIPAKFGFDFRFTLPHKGFHRKIGMFADVHVSPDGRLISEAEWTH 421
           DD+I D  AGV RWN++  K G DFR T+PHK F+R+IG FA   VSPDGR++SE+EW  
Sbjct: 364 DDYIKDSVAGVGRWNKVLDKAGIDFRMTVPHKAFNRQIGTFAGTRVSPDGRVVSESEWAA 423

Query: 422 QHKNWLPTESDRLYVHSLMGRCLEPGKFANWIAAPARGINNQPVNFEYVRFN 473
               WL T  DR YV SLMGR  E GKFANWIA PA G+N QPV+FEYVRFN
Sbjct: 424 NEAKWLATPEDRAYVASLMGRVTEAGKFANWIAPPAMGVNRQPVDFEYVRFN 475


Lambda     K      H
   0.320    0.137    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 844
Number of extensions: 26
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 473
Length of database: 475
Length adjustment: 33
Effective length of query: 440
Effective length of database: 442
Effective search space:   194480
Effective search space used:   194480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory