GapMind for catabolism of small carbon sources

 

Aligments for a candidate for hcl in Burkholderia phytofirmans PsJN

Align 4-hydroxybenzoate--CoA/benzoate--CoA ligase; 4-hydroxybenzoyl-CoA synthetase; EC 6.2.1.25; EC 6.2.1.27 (characterized)
to candidate BPHYT_RS21775 BPHYT_RS21775 long-chain fatty acid--CoA ligase

Query= SwissProt::Q53005
         (539 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS21775 BPHYT_RS21775 long-chain
           fatty acid--CoA ligase
          Length = 553

 Score =  182 bits (463), Expect = 2e-50
 Identities = 151/516 (29%), Positives = 240/516 (46%), Gaps = 48/516 (9%)

Query: 34  LSYGELRDAVARVGPMLARLGVEQENRIALVLKDTVDFPILFWGAIRAGIVPVLLNTRLT 93
           L++ ELRD    +       G++    I++ + + +    L   A+ +G+V   LN    
Sbjct: 43  LTFRELRDDCRALEARFREAGLQPGEVISVFMGNGIQTARLLLAAMYSGLVANPLNLLCQ 102

Query: 94  ADQYRYLLEDSRSRVVFASSEFLPVIEEAAADL--------------------------- 126
             Q RY+++ S +R++FA+S+   VI  A A+L                           
Sbjct: 103 PSQVRYIVDHSDTRMIFAASDTHAVIGAAVAELRAAGLTREIALIQTEPDDAEPPSLAKH 162

Query: 127 -PHLRTIIAVG----DAPAPTLQLANLLATEQEGGAPA-ATCADDIAYWQYSSGTTGMPK 180
            P L    A G     APAP L   ++        A A    ADD+A   Y+SGTTG PK
Sbjct: 163 EPALVEAAAHGASGATAPAPALAKRSVAPRPVTSRATAYEPTADDVALLMYTSGTTGTPK 222

Query: 181 GVMHVHSSPRVMAENAGRRIGYREDDVVFSAAKLFFAYGLGNAMFCPMGIGATSVLYPER 240
           GV+  H +    A N         DD V ++  L+   GL   +  P+  G ++V+   R
Sbjct: 223 GVLLTHRNLVANARNISAEHRLASDDRVLASLPLYHINGLVVTLLAPLFHGGSAVM-TSR 281

Query: 241 PTADSVFDTLRLHQPTLLFAVPTLYAAMLADPRSRTETLPDRLRLCVSAGEPLPAQVGLN 300
            +A + +  + LH  T +  VPT+ A +L    + T  L   L+ C SA   LPA     
Sbjct: 282 FSARTFWRDVALHACTWINVVPTIVAYLLNADEACTYDL-SALKFCRSASAALPADHHRA 340

Query: 301 WRNRFGHDIVNGVGSTEMGHLFLTNLPHAVE---YGTSGVPVDGYRLRLVGDRGQDVADD 357
           +  RFG  ++  +G TE      +N P+ +E    G+ G+P  G   +++   G++ A +
Sbjct: 341 FEARFGIGVIETMGMTETAAPVFSN-PYEMERRRVGSIGLP-SGGEAKVIDREGRECAAN 398

Query: 358 EIGELLVSGGSSAAGYWNQRDKTRTTFVGE-WTRTGDKYHRRADGVYTYCGRTDDIFKVS 416
           E GEL++ G     GY+ + ++T   F  + W RTGD  +R ADG +   GR  ++    
Sbjct: 399 ECGELVLRGEQVMGGYYKRPEETAAAFTSDGWLRTGDLGYRDADGYFYINGRAKELIIKG 458

Query: 417 GIWVSPFEIEQALMSHAKVLEAAVIPAEDTDGLIKPKAFIV---LASRGDIDPGALFDEL 473
           G  ++P EI++AL+ H  VL+AA +   D        AF+V      RG  DP     +L
Sbjct: 459 GENIAPREIDEALLRHPDVLDAAAVGVPDPAYGQDIVAFVVPRMSDGRGAPDPA----DL 514

Query: 474 KEHVKSAIGPWKYPRWIQIMDDLPKTSSGKLQRYLL 509
           +EH    +G +K P+  + +D+LP+  SGK+QR  L
Sbjct: 515 REHCLRELGRYKTPKEFRFVDELPRGPSGKVQRLKL 550


Lambda     K      H
   0.320    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 721
Number of extensions: 43
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 539
Length of database: 553
Length adjustment: 35
Effective length of query: 504
Effective length of database: 518
Effective search space:   261072
Effective search space used:   261072
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory