Align Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase; HMG aldolase; EC 4.1.3.17; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.1.112; Regulator of ribonuclease activity homolog; RraA-like protein (uncharacterized)
to candidate BPHYT_RS24290 BPHYT_RS24290 hypothetical protein
Query= curated2:Q9KBI9 (210 letters) >FitnessBrowser__BFirm:BPHYT_RS24290 Length = 239 Score = 90.5 bits (223), Expect = 2e-23 Identities = 66/200 (33%), Positives = 98/200 (49%), Gaps = 18/200 (9%) Query: 1 MSQAEIDFITQFRTIPTTCISDAL--DGLTN-LTSTIKPL--NENDQVVGPARTVQ-VAS 54 MS + + R + T ++ L GL N + PL + +VGPA T++ + S Sbjct: 1 MSDLDSATLEALRRVSTATLTTQLFKRGLRNTFMQGVAPLAAHSGANLVGPAFTLRNIPS 60 Query: 55 GDNLAVL-----------KAMYEASPGDVIVIDAKGDCTRAIAGDFVLGMAKTLGIAGFV 103 +++ VL K + G V+V D +G+ A G + + G+AG V Sbjct: 61 REDIDVLELFADPEYAQRKCVETIPAGHVLVQDCRGERGSASFGSILTQRLQVRGVAGMV 120 Query: 104 VDGAIRDIRASKALNFPIFCRGTTIAASK-KTGIGNINVPISCGGVPIRPGDLIVGDADG 162 DG +RD AL P+FC G + + + +INVPI CGGV + PGD+IVGDADG Sbjct: 121 SDGPVRDSTTIAALGIPVFCAGASAPPNLIRHHAVDINVPIGCGGVAVFPGDVIVGDADG 180 Query: 163 VTVIPKGQEENVLQKAKKKQ 182 V VIP V Q A +++ Sbjct: 181 VVVIPLKMAAEVAQAAAEQE 200 Lambda K H 0.318 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 239 Length adjustment: 22 Effective length of query: 188 Effective length of database: 217 Effective search space: 40796 Effective search space used: 40796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory