Align protocatechuate 3,4-dioxygenase α subunit (EC 1.13.11.3) (characterized)
to candidate BPHYT_RS33460 BPHYT_RS33460 protocatechuate 3,4-dioxygenase subunit alpha
Query= metacyc::MONOMER-3186 (201 letters) >FitnessBrowser__BFirm:BPHYT_RS33460 Length = 195 Score = 142 bits (358), Expect = 4e-39 Identities = 87/198 (43%), Positives = 118/198 (59%), Gaps = 10/198 (5%) Query: 6 LPETPSQTAGPYVHIGLALEAAGNPTRDQEIWNRLAKPDAPGEHILLLGQVYDGNGHLVR 65 L +TPSQT GPY GL + + LA +A GEHI L+GQ++DG+G+++ Sbjct: 4 LKQTPSQTVGPYFAYGLCPQQYDFDFKSL-FTPVLADREAAGEHITLVGQIFDGDGNVIG 62 Query: 66 DSFLEVWQADANGEYQDAYN--LENAFNSFGRTATTFDAGE-WTLHTVKPGVVNNAAGVP 122 D+ LEV Q D+NG + ++ L+ F F R T D + + + TVKPG A Sbjct: 63 DAMLEVSQVDSNGHFPESREEILKTGFRGFARVGTGTDPHKRFVVETVKPG----RASPD 118 Query: 123 MAPHINISLFARGINIHLHTRLYFDDEAQANAKCPVLNLIEQPQRRETLIAKRCEVDGKT 182 APH+N+ L RG+ +H TR+YF+DEA AN K PVL + +RRETLIA+R E + Sbjct: 119 EAPHLNVILTMRGMLLHTFTRIYFEDEAAANEKDPVLAAV-PAERRETLIARR-EPNVAN 176 Query: 183 AYRFDIRIQGEGETVFFD 200 YRFDI +QG ETVFFD Sbjct: 177 VYRFDIHMQGAKETVFFD 194 Lambda K H 0.319 0.137 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 195 Length adjustment: 20 Effective length of query: 181 Effective length of database: 175 Effective search space: 31675 Effective search space used: 31675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory