Align pimeloyl-CoA dehydrogenase large subunit (EC 1.3.1.62) (characterized)
to candidate BPHYT_RS25380 BPHYT_RS25380 acyl-CoA dehydrogenase
Query= metacyc::MONOMER-20676 (396 letters) >FitnessBrowser__BFirm:BPHYT_RS25380 Length = 399 Score = 327 bits (839), Expect = 3e-94 Identities = 171/391 (43%), Positives = 241/391 (61%), Gaps = 7/391 (1%) Query: 11 AFRDEVRQFFKDNVPAKTRQKLIEGRHNTKEEMVEWYRILNKKGWAVTHWPKEYGGTGWS 70 AFR++VR F ++++P K + + + ++V W +ILN++GW +W K+ GGTGWS Sbjct: 11 AFREQVRAFLREHLPRDLAGKPVGSVRSMRPDLVRWQKILNQQGWGAPYWAKKDGGTGWS 70 Query: 71 SVQHYIFNEELQAAPAPQPLAFGVSMVGPVIYTFGSEEQKKRFLPRIANVDDWWCQGFSE 130 +Q +F+EE AA AP F ++GPV+ F S EQK +P I + WCQGFSE Sbjct: 71 VLQRLVFDEECIAAGAPTQDGFAQKLLGPVLNEFASPEQKGEHVPLILAGERLWCQGFSE 130 Query: 131 PGSGSDLASLKTKAEKKGDKWIINGQKTWTTLAQHADWIFCLCRTDPAAKKQEGISFILV 190 PGSGSDLASL+T+AE+ GD +I+NGQK WT+ A +DWIF L RTD KKQ GISF+LV Sbjct: 131 PGSGSDLASLRTRAERDGDHYIVNGQKIWTSYAHESDWIFLLVRTDTEVKKQAGISFLLV 190 Query: 191 DMKTKGITVRPIQTIDGGHEVNEVFFDDVEVPLENLVGQENKGWDYAKFLLGNERTGIAR 250 DMKT GITVRPI++ID H +NE FFD+V VP+ N VG E GW KFLL NE A Sbjct: 191 DMKTPGITVRPIRSIDDCHHLNETFFDNVRVPVANRVGAEGAGWTITKFLLNNEHASAAD 250 Query: 251 VGMSKERIRRIKQLAAQVESGGKPVIEDPKFRDKLAAVEIELKALELTQLRVVADEGKHG 310 + + + + +++ LAA G +P+I P F +LA +E E+ A+ RV A E H Sbjct: 251 LPILRRYLMQLRTLAATQRVGCEPLIAQPAFALRLARLEAEVSAVATMVKRVAAMEQDHS 310 Query: 311 KGKPNPASSVLKIKGSEIQQATTELLMEVIGPFAA-----PYDVHGDDDSNETMDWTAQI 365 + S+LK++G+E+QQ +EL++E +G + A P+D + + D + Sbjct: 311 PA-AHAMGSILKVRGTELQQRISELMVEALGDYGAVAYPEPHDT-CEAEPLPHQDVARGL 368 Query: 366 APGYFNNRKVSIYGGSNEIQRNIICKAVLGL 396 A F R +IYGG++E+QR II K + L Sbjct: 369 ANEMFFRRASTIYGGTSEVQRGIIAKMLFQL 399 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 399 Length adjustment: 31 Effective length of query: 365 Effective length of database: 368 Effective search space: 134320 Effective search space used: 134320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory