Align 2-oxo-3-hexenedioate decarboxylase (EC 4.1.1.77) (characterized)
to candidate BPHYT_RS07240 BPHYT_RS07240 2-keto-4-pentenoate hydratase
Query= BRENDA::Q1XGK3 (264 letters) >FitnessBrowser__BFirm:BPHYT_RS07240 Length = 273 Score = 160 bits (405), Expect = 3e-44 Identities = 95/258 (36%), Positives = 138/258 (53%), Gaps = 5/258 (1%) Query: 10 VLALAEHIENAELNVHDIGKVTNDFPEMTFADAYDVQWEIRR----RKEARGNKIVGLKM 65 V +A+ + A+ + V N E+ DA D + ++R R+ A G ++VG K+ Sbjct: 9 VQRIADALWRAQQTGVPVAPVRNAIAELG-GDALDAAYAVQRVNTERQLAAGRRLVGRKI 67 Query: 66 GLTSWAKMAQMGVETPIYGFLADYFSVPDGGVVDCSKLIHPKIEAEISVVTKAPLHGPGC 125 GLTS A Q+GV+ P +G L D S+ DG + S+ PK+EAEI++V L Sbjct: 68 GLTSKAVQTQLGVDQPDFGMLFDDMSIADGEEIALSRTQQPKVEAEIALVLARDLPHERN 127 Query: 126 HLGDVIAAIDYVIPTVEVIDSRYENFKFDLISVVADNASSTRFITGGRMASLEEVDLRTL 185 + D+I A Y +P +E++ SR N+ L VADNASS F+ G R L D+ Sbjct: 128 TIADLIGATAYALPAIEIVGSRIANWDIRLTDTVADNASSGLFVLGNRPVKLGAFDIVHC 187 Query: 186 GVVMEKNGEVVELGAGAAVLGHPLSSVAMLANLLAERGEHIPAGTFIMTGGITAAVPVAP 245 G+ ME+ G+ V +G GAA LG+PL + LAN + G + AG ++TG + V Sbjct: 188 GMAMERRGDPVSVGVGAACLGNPLYAAVWLANTMTRVGAPLKAGDIVLTGALGPMAAVQA 247 Query: 246 GDNITVRYQGLGSVSARF 263 GD T +GLGSVSA F Sbjct: 248 GDVFTAHIEGLGSVSASF 265 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 273 Length adjustment: 25 Effective length of query: 239 Effective length of database: 248 Effective search space: 59272 Effective search space used: 59272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory