Align L-alanine and D-alanine permease (characterized)
to candidate BPHYT_RS21680 BPHYT_RS21680 amino acid permease-associated protein
Query= reanno::pseudo5_N2C3_1:AO356_17670 (473 letters) >FitnessBrowser__BFirm:BPHYT_RS21680 Length = 476 Score = 329 bits (844), Expect = 1e-94 Identities = 165/444 (37%), Positives = 264/444 (59%), Gaps = 8/444 (1%) Query: 18 LKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGPAIMLSYIIGGLAILVIMRALGEMA 77 LK L +RH+ ++ALG IG GLF+GS ++ AGPA +LS++I G ++++MR LGEMA Sbjct: 10 LKAGLKQRHMTMIALGGVIGAGLFVGSGVVVQQAGPAAVLSFLITGALVVLVMRMLGEMA 69 Query: 78 VHNPVAGSFSRYAQDYLGP------LAGFLTGWNYWFLWLVTCVAEITAVAVYMGIWFPD 131 P GSF YA+ G LAGFLTGW YW+ W++ E A A + W PD Sbjct: 70 CAMPAVGSFYEYARLAFGGKRASGNLAGFLTGWMYWYFWVIVVAVEAVAGAKLVQFWLPD 129 Query: 132 VPRWIWALAALVSMGSINLIAVKAFGEFEFWFALIKIVTIIAMV-IGGVGIIAFGFGNDG 190 VP W +L LV++ + NL++V ++GEFEFWFA IK+ I+ + +GG+ ++ Sbjct: 130 VPAWAISLVLLVTLTATNLVSVGSYGEFEFWFASIKVAAIMVFLFLGGMYVLGLWPAAKH 189 Query: 191 VALGISNLWAHGGFMPNGVSGVLMSLQMVMFAYLGVEMIGLTAGEAKNPQKTIPNAIGSV 250 V + L +HGG MP G+ VL Y G E++ + A EA+ P K + A SV Sbjct: 190 VTAVLPTLLSHGGLMPKGIGPVLSGAVAATGFYFGAEIVTIAAAEAQEPAKAVAKATNSV 249 Query: 251 FWRILLFYVGALFVILSIYPWNEIGTQGSPFVMTFERLGIKTAAGIINFVVITAALSSCN 310 R+L+FYVG++ +++++ PWN +P+V + +GI AA ++N +V+TA LS+ N Sbjct: 250 ITRVLVFYVGSILLVVALVPWNS-PKMATPYVSALDAMGIPAAASVMNAIVLTAVLSALN 308 Query: 311 GGIFSTGRMLYSLAQNGQAPAGFAKTSTNGVPRRALLLSIAALLLGVLLNYLVPEKVFVW 370 G+++ RM+++L ++G APA AK + GVP RA+L+ V+++Y+ P+ VF + Sbjct: 309 SGLYAASRMIFALTRHGDAPAALAKVNRRGVPVRAILIGTVFGYASVVMSYVSPDTVFAF 368 Query: 371 VTSIATFGAIWTWVMILLAQLKFRKSLSASERAALKYRMWLYPVSSYLALAFLVLVVGLM 430 + + AI+ +V+I ++QLK R + L+ RMW YP +++A+ +V ++ M Sbjct: 369 LVNSYGTVAIFVYVLIAISQLKLRARIERDAPEKLRVRMWCYPYLTWVAIIGMVGILVAM 428 Query: 431 AYFPDTRVALYVGPAFLVLLTVLF 454 A+ P+ R L+ G A L +L + + Sbjct: 429 AFIPEQRQPLWFGVASLGVLLLAY 452 Lambda K H 0.328 0.142 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 645 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 473 Length of database: 476 Length adjustment: 33 Effective length of query: 440 Effective length of database: 443 Effective search space: 194920 Effective search space used: 194920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory