Align D-alanine dehydrogenase (EC 1.4.99.-) (characterized)
to candidate BPHYT_RS21010 BPHYT_RS21010 D-amino acid dehydrogenase
Query= reanno::psRCH2:GFF3724 (432 letters) >FitnessBrowser__BFirm:BPHYT_RS21010 Length = 415 Score = 294 bits (752), Expect = 4e-84 Identities = 162/401 (40%), Positives = 227/401 (56%), Gaps = 2/401 (0%) Query: 1 MRVLVLGSGVVGTASAYYLARAGFEVVVVDRQPAVAMETSFANAGQVSPGYASPWAAPGV 60 MR+L++G+GV+G +SAYYL+RAG++V V DR VA ETSF N GQ+S Y +P A PGV Sbjct: 1 MRILIIGAGVIGLSSAYYLSRAGYDVTVADRHAEVASETSFGNGGQLSYSYVAPLAGPGV 60 Query: 61 PLKAMKWLLQRHAPLAIKLTGDVDQYLWMAQMLRNCTAARYAVNKERMVRLSEYSRDCLD 120 K +WL QR +P+ + V+Q+ W + L CT AR + ++++ LS SR + Sbjct: 61 VSKLPRWLTQRDSPVRFRPKLSVEQWRWCFEFLSACTRARSELTTQKLLSLSFLSRTLMH 120 Query: 121 EL-RAETGIAYEGRQLGTTQLFRTQAQLDAAAKDIAVLERSGVPYELLDRAAIGRVEPAL 179 EL AE + ++ + G L R + +A +A G + L A +EPAL Sbjct: 121 ELIAAEPSLDFDFVRSGKLVLHRDANAMQSAVDLLAFQRTLGCEQQALSADACVEIEPAL 180 Query: 180 AKVAHKLSGALRLPNDQTGDCQMFTSRLAEMALALGVEFRFGQNIQRLEHAGDRIAGVWI 239 A L+G + P++ T DC+ F L + GV F I L+ + + Sbjct: 181 AHARSFLAGGIHTPSEDTADCRRFCKGLEAVLRERGVRFLMNTPIDGLKFGAKGVEAI-C 239 Query: 240 DGKLETADRYVLALGSYSPQMLKPLGIRAPVYPLKGYSLTVPISDPAMAPQSTVLDETYK 299 DG ADR V+A G+ + Q+LKPLGIR +YP+KGYSLT + AP ++ D K Sbjct: 240 DGAPLAADRIVVASGAGAAQLLKPLGIRVAIYPIKGYSLTFDLQPHITAPHVSITDFARK 299 Query: 300 VAITRFDQRIRVGGMAEIAGHDLSLNPRRRETLEMVVGDLYPQGGDPAEAVFWTGLRPAT 359 V R +R+RVGG+A+I G+ L +P R TL L+P+ A + WTGLRPAT Sbjct: 300 VVYARLGERLRVGGIADIGGYSLDADPARFATLRKETATLFPEVAQSAASGEWTGLRPAT 359 Query: 360 PDGTPIIGATAYRNLYLNTGHGTLGWTMACGSGRVLADLLA 400 P G PI+G T Y NL+LN GHG LG+T+A GS +LAD LA Sbjct: 360 PHGLPIVGPTRYPNLWLNVGHGALGFTLATGSAALLADGLA 400 Lambda K H 0.320 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 415 Length adjustment: 32 Effective length of query: 400 Effective length of database: 383 Effective search space: 153200 Effective search space used: 153200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory