Align D-lactate transporter, ATP-binding component (characterized)
to candidate BPHYT_RS21495 BPHYT_RS21495 ABC transporter
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__BFirm:BPHYT_RS21495 Length = 269 Score = 177 bits (450), Expect = 2e-49 Identities = 91/248 (36%), Positives = 149/248 (60%), Gaps = 4/248 (1%) Query: 1 MGILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSV 60 M +L V + K FGGL+A+ DV+ + + A++GPNGAGKST N + G+L P +GS+ Sbjct: 1 MSLLRVSGLCKSFGGLKAVDDVSFDLEAGQLLALLGPNGAGKSTCFNMVNGQLPPSSGSI 60 Query: 61 MFDGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVS 120 DG+ ++G P +I ++G+ R FQ F ++V+EN+ + ++ F + + Sbjct: 61 RLDGQELVGMRPRDIWRLGVGRTFQIAATFNSMTVIENVQMALVSRERKTF---GLWKPA 117 Query: 121 GQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMA 180 G R ++A +L+++ MA H ++ GD +R+E+ + L+ P+LLL+DEPTAGMA Sbjct: 118 GAR-YADEALALLDQVGMASDAHRACGVLAYGDVKRVELAIALANRPKLLLMDEPTAGMA 176 Query: 181 RADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNP 240 + N + L K++ +E I + EH M VVF+ ADR+ VLA+G + E D I+ +P Sbjct: 177 PKERNELMALTKRLVTEHKIGVLFTEHSMDVVFAYADRLIVLARGKLIAEGDADTIRNDP 236 Query: 241 KVREAYLG 248 +V+E Y G Sbjct: 237 RVQEVYFG 244 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 269 Length adjustment: 24 Effective length of query: 227 Effective length of database: 245 Effective search space: 55615 Effective search space used: 55615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory