Align D-lactate oxidase and glycolate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate BPHYT_RS03515 BPHYT_RS03515 D-lactate dehydrogenase
Query= reanno::psRCH2:GFF3771 (353 letters) >FitnessBrowser__BFirm:BPHYT_RS03515 Length = 471 Score = 94.4 bits (233), Expect = 6e-24 Identities = 56/156 (35%), Positives = 86/156 (55%), Gaps = 7/156 (4%) Query: 23 NTPLRIQGSGSK---SFLGLQADGVLLDTREHRGIVSYDPTELVVTVRAGTPLTELETAL 79 N P+ G+GS L +Q GV +D E ++S + +L VTV G +L AL Sbjct: 75 NVPIIPYGNGSSLEGHLLAVQG-GVSIDLSEMNRVLSINAEDLTVTVEPGISRKQLNEAL 133 Query: 80 DEAGQMLPCEPPHFGEGATVGGMIAAGLSGPRRPWSGSVRDFVLGSRVITGQGKHLRFGG 139 + G P +P G A++GGM A SG G++R+ VLG V+ G+ ++ G Sbjct: 134 RDTGLFFPIDP---GADASIGGMSATRASGTNAVRYGTMRENVLGLTVVLADGRVIKTGT 190 Query: 140 EVMKNVAGYDLSRLMAGSFGCLGVLTEVSLKVLPKP 175 K+ AGYDL+R+ GS G LGV+TE+++++ P+P Sbjct: 191 RARKSSAGYDLTRMFVGSEGTLGVITEITVRLYPQP 226 Score = 27.3 bits (59), Expect = 8e-04 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 332 RQLKAALDPQGIFNPGRMYS 351 R +K ALDP + NPG++++ Sbjct: 449 RSIKHALDPHNLMNPGKIFT 468 Lambda K H 0.319 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 353 Length of database: 471 Length adjustment: 31 Effective length of query: 322 Effective length of database: 440 Effective search space: 141680 Effective search space used: 141680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory