Align D-lactate oxidase and glycolate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate BPHYT_RS31650 BPHYT_RS31650 FAD-binding protein
Query= reanno::psRCH2:GFF3771 (353 letters) >FitnessBrowser__BFirm:BPHYT_RS31650 Length = 355 Score = 462 bits (1189), Expect = e-135 Identities = 224/353 (63%), Positives = 269/353 (76%) Query: 1 MSVIANDASAQLLDQVNQALAANTPLRIQGSGSKSFLGLQADGVLLDTREHRGIVSYDPT 60 + ++ D S +L+ +V+QA + TPL I+G SK+FLG G +DTR HRG+VSYDPT Sbjct: 3 IEAVSTDDSERLVAEVSQAQSHGTPLSIRGGNSKAFLGRPVQGTPIDTRSHRGVVSYDPT 62 Query: 61 ELVVTVRAGTPLTELETALDEAGQMLPCEPPHFGEGATVGGMIAAGLSGPRRPWSGSVRD 120 ELV+T RAGTP+ EL LD AGQMLPCEPP F ATVGGM+AAGL+GPRRPWSGSVRD Sbjct: 63 ELVITARAGTPVAELAAVLDAAGQMLPCEPPEFDGTATVGGMVAAGLAGPRRPWSGSVRD 122 Query: 121 FVLGSRVITGQGKHLRFGGEVMKNVAGYDLSRLMAGSFGCLGVLTEVSLKVLPKPRLCTS 180 FVLG RVITG+ HLRFGGEVMKNVAGYD+SRL+AGSFGCLG++TEVS KVLPKPR S Sbjct: 123 FVLGCRVITGRALHLRFGGEVMKNVAGYDVSRLLAGSFGCLGLITEVSFKVLPKPRALGS 182 Query: 181 LRLEIDLERALLKLAEWGQQPIPISAASHDGQALHLRLEGGEGSVGAARERIGGEDLDPG 240 L L+++ AL +L+ W +PIS A+H LH+RLEGG GSV +A +RIGG +LDP Sbjct: 183 LALDLEAGEALRELSAWRPAGLPISGAAHVDGRLHVRLEGGTGSVASAMDRIGGTELDPR 242 Query: 241 YWNDLREQRLAFFADPRPLWRLSLPNNTPALGLPGDQLVDWAGAQRWLKSDADAVTIRGI 300 +W+ LRE RLAFF DPRPLWRLSLPN +P LPGD L+DWAGAQRWLKS+A A TIR I Sbjct: 243 FWDALREHRLAFFDDPRPLWRLSLPNASPLTPLPGDTLLDWAGAQRWLKSEAPATTIRQI 302 Query: 301 AIEVGGHATCFTAGATTNPFQPLAAPLLRYHRQLKAALDPQGIFNPGRMYSEV 353 A GGHATCFT F PL LLR+H++LK LDP+G+FNPGR+Y ++ Sbjct: 303 AHAAGGHATCFTPRVDAERFSPLPPTLLRFHQRLKQQLDPRGLFNPGRLYVDL 355 Lambda K H 0.319 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 355 Length adjustment: 29 Effective length of query: 324 Effective length of database: 326 Effective search space: 105624 Effective search space used: 105624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory