GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glcE in Burkholderia phytofirmans PsJN

Align D-lactate oxidase and glycolate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate BPHYT_RS31650 BPHYT_RS31650 FAD-binding protein

Query= reanno::psRCH2:GFF3771
         (353 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS31650 BPHYT_RS31650 FAD-binding
           protein
          Length = 355

 Score =  462 bits (1189), Expect = e-135
 Identities = 224/353 (63%), Positives = 269/353 (76%)

Query: 1   MSVIANDASAQLLDQVNQALAANTPLRIQGSGSKSFLGLQADGVLLDTREHRGIVSYDPT 60
           +  ++ D S +L+ +V+QA +  TPL I+G  SK+FLG    G  +DTR HRG+VSYDPT
Sbjct: 3   IEAVSTDDSERLVAEVSQAQSHGTPLSIRGGNSKAFLGRPVQGTPIDTRSHRGVVSYDPT 62

Query: 61  ELVVTVRAGTPLTELETALDEAGQMLPCEPPHFGEGATVGGMIAAGLSGPRRPWSGSVRD 120
           ELV+T RAGTP+ EL   LD AGQMLPCEPP F   ATVGGM+AAGL+GPRRPWSGSVRD
Sbjct: 63  ELVITARAGTPVAELAAVLDAAGQMLPCEPPEFDGTATVGGMVAAGLAGPRRPWSGSVRD 122

Query: 121 FVLGSRVITGQGKHLRFGGEVMKNVAGYDLSRLMAGSFGCLGVLTEVSLKVLPKPRLCTS 180
           FVLG RVITG+  HLRFGGEVMKNVAGYD+SRL+AGSFGCLG++TEVS KVLPKPR   S
Sbjct: 123 FVLGCRVITGRALHLRFGGEVMKNVAGYDVSRLLAGSFGCLGLITEVSFKVLPKPRALGS 182

Query: 181 LRLEIDLERALLKLAEWGQQPIPISAASHDGQALHLRLEGGEGSVGAARERIGGEDLDPG 240
           L L+++   AL +L+ W    +PIS A+H    LH+RLEGG GSV +A +RIGG +LDP 
Sbjct: 183 LALDLEAGEALRELSAWRPAGLPISGAAHVDGRLHVRLEGGTGSVASAMDRIGGTELDPR 242

Query: 241 YWNDLREQRLAFFADPRPLWRLSLPNNTPALGLPGDQLVDWAGAQRWLKSDADAVTIRGI 300
           +W+ LRE RLAFF DPRPLWRLSLPN +P   LPGD L+DWAGAQRWLKS+A A TIR I
Sbjct: 243 FWDALREHRLAFFDDPRPLWRLSLPNASPLTPLPGDTLLDWAGAQRWLKSEAPATTIRQI 302

Query: 301 AIEVGGHATCFTAGATTNPFQPLAAPLLRYHRQLKAALDPQGIFNPGRMYSEV 353
           A   GGHATCFT       F PL   LLR+H++LK  LDP+G+FNPGR+Y ++
Sbjct: 303 AHAAGGHATCFTPRVDAERFSPLPPTLLRFHQRLKQQLDPRGLFNPGRLYVDL 355


Lambda     K      H
   0.319    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 523
Number of extensions: 18
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 353
Length of database: 355
Length adjustment: 29
Effective length of query: 324
Effective length of database: 326
Effective search space:   105624
Effective search space used:   105624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory