Align LUD_dom domain-containing protein (characterized, see rationale)
to candidate BPHYT_RS14530 BPHYT_RS14530 membrane protein
Query= uniprot:A0A0C4YFN9 (234 letters) >FitnessBrowser__BFirm:BPHYT_RS14530 Length = 220 Score = 72.8 bits (177), Expect = 5e-18 Identities = 76/241 (31%), Positives = 104/241 (43%), Gaps = 35/241 (14%) Query: 1 MSTLSARERMLGRLRAAA---PATTADASQLDARIDAHYDARREAATPAEL-------AQ 50 M T AR +L R+RAA P +A + A A + A P +L AQ Sbjct: 1 MDTSLARRNILARIRAAQGREPKPSASEREAAADYLARHPAGPRPEMPVDLVAHFIEEAQ 60 Query: 51 AMQAALGASHALAWC-ASAEAWPAQLAGKLAAAGVRRLLLDPAAEQGAALMRALPASVAP 109 M + + AL+ A+A + Q A L A + L AE G Sbjct: 61 KMATTVDSVAALSDVPAAAHRYLTQHALPLQAIAWQTLQDLHWAEAGLT----------- 109 Query: 110 LSYARPIEAWKAELFDTVDAGFTVARSGIAATGTLVLAPDAQTPRTVSLVPPLHIALVYA 169 +E K + D V G T A TGTLVL +T + L+P HIA+V A Sbjct: 110 ------VEFRKPQDGDVV--GLTGCFCATAETGTLVLLSGPETYASAGLLPETHIAIVPA 161 Query: 170 ETL---HPDLHCAARAERWSAGMPTNLVLVSGPSKTSDIQQTLAYGAHGPRELWVIIVTG 226 + H + R ER +P + VSGPS+T DI+QT+ GAHGP + VI+V G Sbjct: 162 SRIVSGHEEAFALIRKERGE--LPRAVNFVSGPSRTGDIEQTIVLGAHGPYRVHVIVVQG 219 Query: 227 S 227 + Sbjct: 220 A 220 Lambda K H 0.317 0.127 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 234 Length of database: 220 Length adjustment: 22 Effective length of query: 212 Effective length of database: 198 Effective search space: 41976 Effective search space used: 41976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory