Align Glucose kinase (characterized, see rationale)
to candidate BPHYT_RS05010 BPHYT_RS05010 RpiR family transcriptional regulator
Query= uniprot:Q8P6S9 (338 letters) >FitnessBrowser__BFirm:BPHYT_RS05010 Length = 638 Score = 164 bits (414), Expect = 7e-45 Identities = 102/301 (33%), Positives = 154/301 (51%), Gaps = 11/301 (3%) Query: 21 ADVGGTHVRLALACESNDPRKPVTVLDYRKYRCADYPGLAEIMAAFFAELSCAPVRRGVI 80 AD+GGT+ R AL P + + Y CADYPG+AE++ + + V I Sbjct: 24 ADIGGTNARFALETS------PGEIGSVKVYPCADYPGVAEVIKKYLKDTKIGRVNHAAI 77 Query: 81 ASAGYALEDGRVITANLPWVLAPEQIRQQLGMQALHLVNDFEAVAYAANYMTGNQVMQLS 140 A A ++ +V N W + E R+ LG L +VNDF A+A A +T Q +Q+ Sbjct: 78 AIAN-PVDGDQVSMTNHDWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQVG 136 Query: 141 GPAQGAPGPALVLGPGTGLGAALWIPNGGNSVVLPTEAGHAALAAASDLEVALLQELRRT 200 A+ +LGPGTG+G + IP + L +E GHA A A + E +LQ R+ Sbjct: 137 VGARRPNSVIGLLGPGTGMGVSGLIPADDRWIALGSEGGHATFAPADEREDIVLQYARKK 196 Query: 201 RTHVATEHFLSGPGLLTLYTALATLRDAPAVHAT--PAAVTAAALAGDDVLAHEALQTFC 258 +HV+ E +GPG+ +Y ALA RD V A + AL G+ LA E++ FC Sbjct: 197 WSHVSFERVAAGPGIEVIYRALAG-RDKKRVAANVDTIEIVKRALEGEP-LAAESVDVFC 254 Query: 259 GFMGSVVGDMMLLYGVRSGVYLAGGFLPQIADFIARSDFAARLLDKGPLRPALEQVPVRI 318 G +G+ G++ + G G+Y+ GG +P++ +F +RS F R KG L+ VP + Sbjct: 255 GILGTFAGNIAVTLGALGGIYIGGGVVPRLGEFFSRSSFRKRFEAKGRFEAYLQNVPTYV 314 Query: 319 V 319 + Sbjct: 315 I 315 Lambda K H 0.321 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 638 Length adjustment: 33 Effective length of query: 305 Effective length of database: 605 Effective search space: 184525 Effective search space used: 184525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory