GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deh in Burkholderia phytofirmans PsJN

Align The acetate/monochloroacetate (haloacid) permease, Deh4p (Km = 5.5 mμM for acetate; 9 mμM for monochloroacetate) (characterized)
to candidate BPHYT_RS12995 BPHYT_RS12995 MFS transporter

Query= TCDB::Q7X4L6
         (552 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS12995 BPHYT_RS12995 MFS
           transporter
          Length = 489

 Score =  214 bits (546), Expect = 5e-60
 Identities = 117/311 (37%), Positives = 181/311 (58%), Gaps = 12/311 (3%)

Query: 18  RRVIFASSLGTVFEWYDFYLAGSLAIYISRTFFSGVNPAAGFVFTLLGFAAGFAVRPFGA 77
           +R + A +LG   EW+DF +   +A+ + + FF   +PAA  + T   FAA F VRP G 
Sbjct: 32  KRAVGAMALGNAMEWFDFGVYSYIAVTLGKVFFPSASPAAQLIATFGTFAAAFLVRPVGG 91

Query: 78  IVFGRLGDMIGRKYTFLATILLMGLSTFVVGLLPGYGTIGMTAPVVFIAMRMLQGLALGG 137
           +VFG LGD IGR+     T+++M L TF +GL+P Y TIG+ AP++ +  R++QG + GG
Sbjct: 92  MVFGPLGDRIGRQRVLAMTMIMMALGTFAIGLIPSYTTIGIFAPMLLLVARLVQGFSTGG 151

Query: 138 EYGGAATYVAEHAPSNKRGAWTAWIQTTATLGLFISLLVILSVRSLLNEDTFAAWGWRVP 197
           EYGGAAT++AE +   +RG   ++++    +G  +    +  + + L+ D   +WGWRVP
Sbjct: 152 EYGGAATFIAEFSTDKRRGFMGSFLEFGTLIGYVLGAGTVAVLTATLSNDALLSWGWRVP 211

Query: 198 FLVSIVLLAVSVWIRMQLHESPVFERIKAEGKTS--KAPLSEAFG-----QWKNLKIVLL 250
           FL++  L  V ++IRM+L E+P F++ +AE + +  KA   ++FG     QWK     LL
Sbjct: 212 FLIAGPLGLVGLYIRMKLEETPAFKK-QAEQREAEDKAVPKQSFGQLLAQQWK----PLL 266

Query: 251 ALFGLTAGQAVVWYTGQFYTLFFLTQTLKVDGTSANMLVAVALLIGTPFFLFFGSLSDKI 310
              GL     V  Y    Y   +L+ TL  + T    LV + +++  P  L  G LSD I
Sbjct: 267 LCVGLVLIFNVTDYMALSYLPSYLSATLHFNETHGLFLVLLVMVLMMPMTLAAGRLSDTI 326

Query: 311 GRKPIIMAGCL 321
           GRKP+++ GC+
Sbjct: 327 GRKPVMLFGCV 337



 Score = 41.6 bits (96), Expect = 7e-08
 Identities = 28/110 (25%), Positives = 57/110 (51%), Gaps = 6/110 (5%)

Query: 439 GYPAKADPALINWPMSILI-----LTILVLYVTMVYGPLAAMLVEMFPARIRYTSMSLPY 493
           G  A + PAL+   M  ++     L IL + ++   G + + L  +FP +IRY ++++ +
Sbjct: 338 GLFALSIPALLLIRMGTVLPVFGGLMILGVLLSCFTGVMPSALPALFPTKIRYGALAIGF 397

Query: 494 HIGNGWFGGFLPATAFAIIAARGNIYSGLWYPIVIASVAFVIGTLFVKET 543
           +I    FGG  P     ++   GN+    +Y ++ AS+  ++  + ++ET
Sbjct: 398 NISVSLFGGTTPLVTAWLVDRTGNLMMPAYY-LMGASLIGIVSVVALRET 446



 Score = 27.7 bits (60), Expect = 0.001
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 8/88 (9%)

Query: 251 ALFGLTAGQAVVWYTGQFYTLFFLT--QTLKVDGTSANMLVAV------ALLIGTPFFLF 302
           A+  +  G A+ W+    Y+   +T  +      + A  L+A       A L+     + 
Sbjct: 34  AVGAMALGNAMEWFDFGVYSYIAVTLGKVFFPSASPAAQLIATFGTFAAAFLVRPVGGMV 93

Query: 303 FGSLSDKIGRKPIIMAGCLIAALTYFPL 330
           FG L D+IGR+ ++    ++ AL  F +
Sbjct: 94  FGPLGDRIGRQRVLAMTMIMMALGTFAI 121


Lambda     K      H
   0.325    0.139    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 626
Number of extensions: 42
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 552
Length of database: 489
Length adjustment: 35
Effective length of query: 517
Effective length of database: 454
Effective search space:   234718
Effective search space used:   234718
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory