GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deh in Burkholderia phytofirmans PsJN

Align The acetate/monochloroacetate (haloacid) permease, Deh4p (Km = 5.5 mμM for acetate; 9 mμM for monochloroacetate) (characterized)
to candidate BPHYT_RS30290 BPHYT_RS30290 MFS transporter

Query= TCDB::Q7X4L6
         (552 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS30290 BPHYT_RS30290 MFS
           transporter
          Length = 452

 Score =  216 bits (549), Expect = 2e-60
 Identities = 117/323 (36%), Positives = 182/323 (56%), Gaps = 7/323 (2%)

Query: 14  TSEERRVIFASSLGTVFEWYDFYLAGSLAIYI-SRTFFS-GVNPAAGFVFTLLGFAAGFA 71
           TS+ RR +  + LG V EWYDF+L G+ A  +  + FF  G +P  G +    GF  GF 
Sbjct: 18  TSKVRRAVTTAVLGQVLEWYDFFLYGTAAALVFGKLFFPVGSDPLTGTIAAFGGFTVGFI 77

Query: 72  VRPFGAIVFGRLGDMIGRKYTFLATILLMGLSTFVVGLLPGYGTIGMTAPVVFIAMRMLQ 131
            RP G ++ G +GD  GRK   + T+L+MG +T  +GLLP Y  +G+ AP++ + +R+LQ
Sbjct: 78  ARPIGGVLCGHIGDRYGRKTVMMLTLLVMGTATVCMGLLPTYQQVGIAAPIMLVLLRVLQ 137

Query: 132 GLALGGEYGGAATYVAEHAPSNKRGAWTAWIQTTATLGLFISLLVILSVRSLLNEDTFAA 191
           GLA GGE+ G+   + E AP+++RGA  AW    A  G  +S    L V++L   D F +
Sbjct: 138 GLAAGGEWSGSILLIHESAPASRRGALAAWSPCGAAFGFVLSTAAFLLVQTLSPAD-FHS 196

Query: 192 WGWRVPFLVSIVLLAVSVWIRMQLHESPVFERIKAEGKTSKAPLSEAFGQWKNLKIVLLA 251
           WGWRVPFL S  L+A+ +W+R  + ES  F  +KA  + ++ P+ E   Q       +L 
Sbjct: 197 WGWRVPFLCSAALVALGLWMRRSVDESAEFAAVKATHRDARMPVVEVLRQCPR---QVLT 253

Query: 252 LFGLTAGQAVVWYTGQFYTLFFLTQTLKVDGTSANMLVAVALLIGTPFFLFFGSLSDKIG 311
           +FGL  G+    Y    +++ +  Q + +  +     + V++L+  P  L  G L+D++G
Sbjct: 254 VFGLRFGEGAASYIFFAFSIAY-GQFIGLKSSWVLGGLTVSMLLMIPVSLLMGRLTDRVG 312

Query: 312 RKPIIMAGCLIAALTYFPLFKAL 334
           RKP+ +AG +   L  +P F  L
Sbjct: 313 RKPVYLAGAVAMVLVAYPYFTLL 335



 Score = 32.3 bits (72), Expect = 4e-05
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 4/79 (5%)

Query: 77  AIVFGRLGDMIGRKYTFLATILLMGLSTFVVGLLPGYGTIGMTAPVVFIAMRMLQGLALG 136
           +++ GRL D +GRK  +LA  + M L  +    L G G +      V  A+ +   + LG
Sbjct: 301 SLLMGRLTDRVGRKPVYLAGAVAMVLVAYPYFTLLGSGVLWK----VITALVLANSITLG 356

Query: 137 GEYGGAATYVAEHAPSNKR 155
              G    +++E  P + R
Sbjct: 357 ILEGAQPAFISELLPVHLR 375


Lambda     K      H
   0.325    0.139    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 594
Number of extensions: 30
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 552
Length of database: 452
Length adjustment: 34
Effective length of query: 518
Effective length of database: 418
Effective search space:   216524
Effective search space used:   216524
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory