Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate BPHYT_RS04435 BPHYT_RS04435 ABC transporter
Query= TCDB::P21629 (255 letters) >FitnessBrowser__BFirm:BPHYT_RS04435 Length = 646 Score = 213 bits (541), Expect = 1e-59 Identities = 114/249 (45%), Positives = 156/249 (62%), Gaps = 1/249 (0%) Query: 5 ILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRL 64 IL++ G+ M+F GL A+N V+L V+ + +IGPNG+GK+T+ N LTG Y PT G + Sbjct: 391 ILQLRGILMQFSGLKALNDVDLTVQRGTIHGLIGPNGSGKSTMMNVLTGIYVPTAGTLEY 450 Query: 65 DGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFR 124 G + G +IA G+ RTFQNV+LF EMTA+EN+LV H N N + +R Sbjct: 451 RGASLAGKTSAQIALSGIARTFQNVQLFGEMTALENVLVGLHHTFNANLADVGLMSSRYR 510 Query: 125 RSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGL 184 R ER A E A L V L A A L YG+QR LEIAR + P++L+LDEPAAGL Sbjct: 511 REERAARERAFGMLRFVGLDNVAAEEARNLPYGKQRLLEIARALALDPQLLLLDEPAAGL 570 Query: 185 NPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRDN 244 + +L A+I K+R +H +TV+LIEH M +VMS+ D + V++ G +A+G P I+ N Sbjct: 571 TAPDIKELVAIIRKVR-DHGITVVLIEHHMDVVMSVCDRVSVLDFGQKIAEGKPADIQSN 629 Query: 245 PDVIKAYLG 253 VI+AYLG Sbjct: 630 EKVIEAYLG 638 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 646 Length adjustment: 31 Effective length of query: 224 Effective length of database: 615 Effective search space: 137760 Effective search space used: 137760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory