Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate BPHYT_RS26470 BPHYT_RS26470 MFS transporter
Query= reanno::pseudo5_N2C3_1:AO356_20240 (272 letters) >FitnessBrowser__BFirm:BPHYT_RS26470 Length = 248 Score = 141 bits (355), Expect = 2e-38 Identities = 90/250 (36%), Positives = 132/250 (52%), Gaps = 5/250 (2%) Query: 19 LKDKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAQKVEAVAAHWRERGADVHALQAD 78 + VVL+TGA GIG A AFA ARLV+S + + +A+ RE GAD H +QAD Sbjct: 1 MSQPVVLITGALTGIGRATAFAFADSGARLVVSGRREVEGKALEKELRELGADAHFIQAD 60 Query: 79 VSKQQDLQAMARRAVELHGRIDVLVNCAGVNVFRDPL-EMTEEDWRRCFAIDLDGAWYGC 137 V + ++ + + V GRID VN AG + T E + F ++ G Sbjct: 61 VRRDDEVANLVDQTVARFGRIDAAVNNAGTEGQPGAITSQTVESYSATFDTNVLGTLLSM 120 Query: 138 KAVLPQMIEQGVGSIINIASVHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNA 197 K L M Q GS++N++S + Y +KH + G+T++ +E A GVRVNA Sbjct: 121 KHELRVMSAQKSGSVVNVSSTYGHEGAAFASVYAGSKHAVEGMTKSAALEVASTGVRVNA 180 Query: 198 IAPGYIETQLNVDYWNGFADPHAERQRALDLHPPRRVGQPIEVAMTAVFLASDEAPFINA 257 +APG +T + +D + G + A + P RVGQP++VA VFLAS+ A FI Sbjct: 181 VAPGPTDTGM-LDRFTGTPENKAALAAKV---PLGRVGQPVDVARAVVFLASEAASFITG 236 Query: 258 SCITIDGGRS 267 +T+DGG++ Sbjct: 237 QILTVDGGKT 246 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 248 Length adjustment: 24 Effective length of query: 248 Effective length of database: 224 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory