GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xacD in Burkholderia phytofirmans PsJN

Align L-arabonate dehydratase (EC 4.2.1.25) (characterized)
to candidate BPHYT_RS31695 BPHYT_RS31695 dihydroxy-acid dehydratase

Query= reanno::BFirm:BPHYT_RS19730
         (577 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS31695 BPHYT_RS31695
           dihydroxy-acid dehydratase
          Length = 595

 Score =  476 bits (1224), Expect = e-138
 Identities = 265/594 (44%), Positives = 372/594 (62%), Gaps = 23/594 (3%)

Query: 5   NQTKKPLRSQAWFGLKDRDGF--LHRSWMKNQGIPHDEFDG-RPVIGICNTWSELTPCNA 61
           N+ +K LRS+AWF   D      L+     N G+  +E    RPVIGI  T S+L+PCN 
Sbjct: 4   NRDRKSLRSRAWFNNSDNPAMTALYLERFMNYGLTLEELKSERPVIGIAQTGSDLSPCNR 63

Query: 62  HFRELAEYVKKGVHEAGGLPLEFPVMSLGETNLRPTAMLFRNLASMDVEESIRGNPMDGV 121
           H  ELA+ VK G+ +AGG+P+EFPV  + ET  RPTA L RNLA + + E++ G P DGV
Sbjct: 64  HHVELAQRVKDGIRDAGGIPIEFPVHPIQETVRRPTASLDRNLAYLGLVEALYGYPFDGV 123

Query: 122 ILLVGCDKTTPALLMGAASCNLPALAVSGGPMLNGRFRGKNIGSGTGVWQMSEEVRAGTM 181
           +L  GCDKTTPA+LMGAA+ ++P++ +SGGPMLN  ++G+  GSGT +W    E+ AG M
Sbjct: 124 VLTTGCDKTTPAMLMGAATVDIPSIVLSGGPMLNAWYKGERAGSGTIIWHARSELAAGRM 183

Query: 182 TQEEFTEAESCMNRSRGHCMTMGTASTMASMVESLGMGLPHNAAIPAVDARRQVLAHLAG 241
             +EF    +    S GHC +MGTA +M S+ E LGM LP    IPA    R  +A+  G
Sbjct: 184 DYDEFLSCVANSAPSIGHCNSMGTALSMNSLAEVLGMSLPGCGTIPAPYRERGQMAYQTG 243

Query: 242 RRIVDMVREDLTMDKILTRQAFENAIRTNAAIGGSTNAVVHLIALAKRIGVELSLEDWE- 300
           R+IV +V +D+    +LTR+AFENAI   +AIG STN   H+ A+A+ IGV+L + DW+ 
Sbjct: 244 RQIVQLVHDDVRPSSLLTREAFENAIVVASAIGASTNCPPHINAIARHIGVDLDIRDWDR 303

Query: 301 LGSNVPCLVNLQPSGEYLMEDFYYAGGLPAVLKQLGEQGLLHKEALTVNGKTLWDNVRNA 360
           LG ++P LVN  P+G+YL E+F+ AGG+ AV+ +L + G LH +  TV+GKTL     ++
Sbjct: 304 LGYDIPLLVNCMPAGKYLGEEFHRAGGVAAVVHELLKAGKLHGDVQTVSGKTLAQCYGDS 363

Query: 361 ANYDEKVITTFAEPFKPKAGIAVLKGNLAPNGAVIKPSAATASLLKHR------------ 408
              D  VI  +A P K +AG AVL GNL  + AV+K S  +    +H+            
Sbjct: 364 PATDADVIRPYASPLKSEAGFAVLGGNLF-DSAVMKTSVISDD-FRHKYLENPADPGAFE 421

Query: 409 GRAVVFENIEELHAKIDDESLDIDEHCIMVLKGAGPKGYPGFAEVGNMPLPKKVLQKGIT 468
           GRA+VFE  E+ H +IDD +L+IDE+CI+ ++G GP GYPG AEV NM  P +++++G+T
Sbjct: 422 GRAIVFEGPEDYHDRIDDPALEIDENCILFIRGTGPVGYPGAAEVVNMIPPSELIKRGVT 481

Query: 469 DMVRISDGRMSGTAYGAVVLHVSPEAAAGGPLAFVQTGDMIELDVEERRLHLDVTDEELA 528
            +  + DGR SGT+    +L+ SPE+A GG LA +QTGD +  D+  RR  + V ++EL 
Sbjct: 482 LLPCVGDGRQSGTSASPSILNASPESAIGGGLAILQTGDRVRFDLTRRRADMLVPEDELD 541

Query: 529 RRRAAWQAPE-APKRGYYKLYVEHVLQADQGADLDFLVGSSGAP----VPRDSH 577
           RRR  W+A E   +  + +L+  +V Q + GA LDF V          VPRD+H
Sbjct: 542 RRRREWKAYEFVNQTPWQELHRRYVGQLEDGACLDFSVKYQRVAEVHGVPRDNH 595


Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 912
Number of extensions: 47
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 577
Length of database: 595
Length adjustment: 37
Effective length of query: 540
Effective length of database: 558
Effective search space:   301320
Effective search space used:   301320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory